(data stored in SCRATCH zone)

EMBL: CP002417.PE390

CP002417.PE390       Location/Qualifiers
FT   CDS             complement(415779..417299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0391"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vap:Vapar_0372 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34613"
FT                   /db_xref="GOA:E6V3C3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU34613.1"
FT                   /translation="MSALLELKGISKRFGASRALSGVDFSLHAGEIHALCGENGAGKST
FT                   LMNIIDGIHRPDEGEILLNGQKVVIDGPAHAMRLGIGLVHQEIALCADATVAENIFMPE
FT                   INAGKAAWMNYASFNERAAKVLRRLGQDIDPATPVGDLSISSQQLVEIAKALTLDCKVL
FT                   ILDEPTAALTDNESAALFRVLHDLKAQGIGIIYISHRMAEIFTHCDRVTVLRDGRNVHC
FT                   GPLAGSTPDELVRRMVGRDLGNYYPPKQSASPTAESSGPVLEVNDIADGERVHGVSFAL
FT                   KRGEILGIAGLMGAGRSELAETICGLRIAKRGAVRLNGKTLTIRKYSDALRAGIAYLSE
FT                   DRKAAGVFLDLPIAQNVSSMALSRVSSAWGLLQRSAEHKLAKTLGAKLNLKSDGVAIEV
FT                   SSLSGGNQQKVAIAKLLATNPSVLLMDEPTRGVDVGAKSEIHHILRELANQGVGVIVIS
FT                   SELPEIIGLCDRALVIRDGQVAGELEANEMTEEALLRLASGLCEQETA"
     MSALLELKGI SKRFGASRAL SGVDFSLHAG EIHALCGENG AGKSTLMNII DGIHRPDEGE        60
     ILLNGQKVVI DGPAHAMRLG IGLVHQEIAL CADATVAENI FMPEINAGKA AWMNYASFNE       120
     RAAKVLRRLG QDIDPATPVG DLSISSQQLV EIAKALTLDC KVLILDEPTA ALTDNESAAL       180
     FRVLHDLKAQ GIGIIYISHR MAEIFTHCDR VTVLRDGRNV HCGPLAGSTP DELVRRMVGR       240
     DLGNYYPPKQ SASPTAESSG PVLEVNDIAD GERVHGVSFA LKRGEILGIA GLMGAGRSEL       300
     AETICGLRIA KRGAVRLNGK TLTIRKYSDA LRAGIAYLSE DRKAAGVFLD LPIAQNVSSM       360
     ALSRVSSAWG LLQRSAEHKL AKTLGAKLNL KSDGVAIEVS SLSGGNQQKV AIAKLLATNP       420
     SVLLMDEPTR GVDVGAKSEI HHILRELANQ GVGVIVISSE LPEIIGLCDR ALVIRDGQVA       480
     GELEANEMTE EALLRLASGL CEQETA                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page