(data stored in ACNUC1104 zone)

EMBL: CP002417.PE391

CP002417.PE391       Location/Qualifiers
FT   CDS             complement(417296..418342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0392"
FT                   /product="sugar ABC transporter"
FT                   /note="KEGG: vap:Vapar_0373 sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34614"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0373"
FT                   /protein_id="ADU34614.1"
FT                   /translation="MRRNFLKSAAAAGIGLAGASAFAQQQAAAPAAGTGLRGNASDVYV
FT                   MNVMVSGVEYWFPVYEMMKQLGRTLGVKTRYTGTPEYDVNKQLASFEQELARKPAGILL
FT                   HPMNPDPFIEPINRAAAMGIPVVTFAADSPNSKRTSFVTSDNDREGTQAADAIAASLNG
FT                   KGEYAVLENPGQDNHDRRIAAFVNRMKTKHTGMKLVGRAASNQDPNKAYQAVLSLAQAN
FT                   PNLGALFMPEANSALGAAQAKVETKKNIKVMCCDVNAKILDMIKSGDVFGAINPNQGMQ
FT                   GYMGMMMLFLAKNPSLIDPMNDAKRNGTNPMAVPFLDNGLAVVSKANADDFYWDKYLAR
FT                   RGTKGIGE"
     MRRNFLKSAA AAGIGLAGAS AFAQQQAAAP AAGTGLRGNA SDVYVMNVMV SGVEYWFPVY        60
     EMMKQLGRTL GVKTRYTGTP EYDVNKQLAS FEQELARKPA GILLHPMNPD PFIEPINRAA       120
     AMGIPVVTFA ADSPNSKRTS FVTSDNDREG TQAADAIAAS LNGKGEYAVL ENPGQDNHDR       180
     RIAAFVNRMK TKHTGMKLVG RAASNQDPNK AYQAVLSLAQ ANPNLGALFM PEANSALGAA       240
     QAKVETKKNI KVMCCDVNAK ILDMIKSGDV FGAINPNQGM QGYMGMMMLF LAKNPSLIDP       300
     MNDAKRNGTN PMAVPFLDNG LAVVSKANAD DFYWDKYLAR RGTKGIGE                    348
//

If you have problems or comments...

PBIL Back to PBIL home page