(data stored in ACNUC1104 zone)

EMBL: CP002417.PE393

CP002417.PE393       Location/Qualifiers
FT   CDS             420066..421826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0394"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /note="KEGG: vap:Vapar_0375 FAD dependent oxidoreductase;
FT                   PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34616"
FT                   /db_xref="GOA:E6V3C6"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C6"
FT                   /inference="protein motif:PRIAM:1.1.5.3"
FT                   /protein_id="ADU34616.1"
FT                   /translation="MSAWQLPFVRPASLADRHFSTVIVGAGINGVGVFRDLSLQRVDCL
FT                   IVDKGDFGAGASSAPSRMIHGGLRYLENGSFSLVAEATRERNLLLRNAPHLVRPLKTVV
FT                   PLANFFGGLMSSALKFFGRTPPQRTRGLLAVALGLRLYDILGRRQRVMPGHRISRVPTN
FT                   DRGLFRAAIRWTATFFDAWISHPEWLILELIGDACRDQPRSAAANYCRVMGCAGNILTL
FT                   RDELTGALVRVTADTVVNATGAWLDRSAAVLGGAGPRVMGTKGSHLVLDHPALRDALDG
FT                   RMAYFEAVDGRVCIVYPFLDRVLVGSTDIPVEDPDQIVTEPAEVDYLIDVLREVFPNMA
FT                   FGRDHVVYTYVGVRPLARSDADKPGQISRDHSVVVDPPSATRDIPIVGLVGGKWTTFRS
FT                   LAEEATTEVLQLLGRSRTASTELLPIGGGADLPADAAATERFIEKMTASGMGRARALTL
FT                   LARYGSKALPLAQRLAASGDVPLQHAPDYSAAELSYLCLETGVVHLDDLVIRRTLLAIR
FT                   GLVTDAALAEISGIAAEALGWDAARAHKELRTCATALREHHNVRLQAVAPDVEPSFDAS
FT                   LMASSALGQS"
     MSAWQLPFVR PASLADRHFS TVIVGAGING VGVFRDLSLQ RVDCLIVDKG DFGAGASSAP        60
     SRMIHGGLRY LENGSFSLVA EATRERNLLL RNAPHLVRPL KTVVPLANFF GGLMSSALKF       120
     FGRTPPQRTR GLLAVALGLR LYDILGRRQR VMPGHRISRV PTNDRGLFRA AIRWTATFFD       180
     AWISHPEWLI LELIGDACRD QPRSAAANYC RVMGCAGNIL TLRDELTGAL VRVTADTVVN       240
     ATGAWLDRSA AVLGGAGPRV MGTKGSHLVL DHPALRDALD GRMAYFEAVD GRVCIVYPFL       300
     DRVLVGSTDI PVEDPDQIVT EPAEVDYLID VLREVFPNMA FGRDHVVYTY VGVRPLARSD       360
     ADKPGQISRD HSVVVDPPSA TRDIPIVGLV GGKWTTFRSL AEEATTEVLQ LLGRSRTAST       420
     ELLPIGGGAD LPADAAATER FIEKMTASGM GRARALTLLA RYGSKALPLA QRLAASGDVP       480
     LQHAPDYSAA ELSYLCLETG VVHLDDLVIR RTLLAIRGLV TDAALAEISG IAAEALGWDA       540
     ARAHKELRTC ATALREHHNV RLQAVAPDVE PSFDASLMAS SALGQS                      586
//

If you have problems or comments...

PBIL Back to PBIL home page