(data stored in SCRATCH zone)

EMBL: CP002417.PE395

CP002417.PE395       Location/Qualifiers
FT   CDS             complement(422604..423497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0396"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: vap:Vapar_0377 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34618"
FT                   /db_xref="GOA:E6V3C8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C8"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADU34618.1"
FT                   /translation="MPSFTPRQFVLLVLLTLAWGFNWPVMKLGVADYPPLAFRAISIWL
FT                   GLPVLGIALVWMKVPFRVPRSAWPELVWLGATNMFVWHACIILAVKALSGGRAAILGYT
FT                   MPVFSAVIGALLFSAVLTRRSWIGVGACAVGVGLLLWHELTDFAGRPGYVALALVAAAT
FT                   WALGTQLLRHTRIGLPTLTLSFWMTAMTAVVMTVLSLLFERGPWRWPGTVTWGSILYNA
FT                   VLIFGFAHAAWFYLARGLPPVASTLSVMFIPVLGVFSGAVWLGEVVHWQDWVAVALMMV
FT                   AIASVLWPSRGNAAKA"
     MPSFTPRQFV LLVLLTLAWG FNWPVMKLGV ADYPPLAFRA ISIWLGLPVL GIALVWMKVP        60
     FRVPRSAWPE LVWLGATNMF VWHACIILAV KALSGGRAAI LGYTMPVFSA VIGALLFSAV       120
     LTRRSWIGVG ACAVGVGLLL WHELTDFAGR PGYVALALVA AATWALGTQL LRHTRIGLPT       180
     LTLSFWMTAM TAVVMTVLSL LFERGPWRWP GTVTWGSILY NAVLIFGFAH AAWFYLARGL       240
     PPVASTLSVM FIPVLGVFSG AVWLGEVVHW QDWVAVALMM VAIASVLWPS RGNAAKA          297
//

If you have problems or comments...

PBIL Back to PBIL home page