(data stored in ACNUC1104 zone)

EMBL: CP002417.PE396

CP002417.PE396       Location/Qualifiers
FT   CDS             complement(423513..426629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0397"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="KEGG: vap:Vapar_0378 excinuclease ABC, A subunit;
FT                   TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34619"
FT                   /db_xref="GOA:E6V3C9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C9"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ADU34619.1"
FT                   /translation="MSGCPRTIAPLNSKATEELAAQEESARDAQRERDTYLGAVLAQQR
FT                   ISIRGARTHNLKNVDLDIPRNKLVVITGLSGSGKSSLAFDTLYAEGQRRYVESLSAYAR
FT                   QFLQLMDKPDVDVIEGLSPAISIEQKATSHNPRSTVGTVTEIHDYLRLLFARAGTPYCP
FT                   DHHLPLQAQTVSQMVDATLAIPDEPRLLILAPVAREKKGEFLELFAEMQAAGYVRFRVD
FT                   GQTYEYNDLPKLKKTEKHDIDVVIDRLRARPDMQQRLAESFEAALRLAEGRAIALELGA
FT                   EGVADKEHLFNAKFACPICHYSLSELEPRLFSFNSPVGACPSCDGLGHREVFDPARVVA
FT                   FPSLSIASGAIKGWDRRNGYYFSMIESVAKHYKFDVDAPFESLPASVQQVLLNGSAAEE
FT                   IKFNYTMESGNFAGKKLTKKHPFEGIIPNMTRRYRETDSVMVREDLARFRNLQPCPDCG
FT                   GSRLRREARNVFLVDESARPADGGEPPRMAIFELSHLTLRDSLAWFQTLKLRGAKADIA
FT                   DKVVREIGLRLKFLNDVGLNYLSLDRSAETLSGGEAQRIRLASQIGSGLTGVMYVLDEP
FT                   SIGLHQRDNDRLIGTLKHLRDIGNSVIVVEHDEDMIHAADHVIDMGPGAGVHGGRVMAQ
FT                   GTYAEVSANPDSLTGQYLSGTKKIEVPKHRTAWLPAVKKPAFNEGKKPSRFPQSPAAER
FT                   RAAREAAHIASQTDLQEIRVVGATGNNLKNVSVAFPVGLLTCVTGVSGSGKSTLVNDTL
FT                   YTAVARTLYRAHEEPAEHESVEGIEYFDKVINVDQSPIGRTPRSNPATYTGLFTPIREL
FT                   MAETNTARERGYGPGRFSFNVAGGRCEACQGDGVVKVEMHFLPDVYVPCEVCHGQRYNR
FT                   ETLEVQYKGKNIAQILEMTVETAHEFLKAVPTIERKLRTLLDVGLSYIKLGQSATTLSG
FT                   GEAQRVKLALELSKRDTGRTLYILDEPTTGLHFADIELLLKVLHQLRDAGNTIVVIEHN
FT                   LDVIKTADWLIDMGPEGGAGGGTVVGEGTPEDIAANEASHTGRYLKRLL"
     MSGCPRTIAP LNSKATEELA AQEESARDAQ RERDTYLGAV LAQQRISIRG ARTHNLKNVD        60
     LDIPRNKLVV ITGLSGSGKS SLAFDTLYAE GQRRYVESLS AYARQFLQLM DKPDVDVIEG       120
     LSPAISIEQK ATSHNPRSTV GTVTEIHDYL RLLFARAGTP YCPDHHLPLQ AQTVSQMVDA       180
     TLAIPDEPRL LILAPVAREK KGEFLELFAE MQAAGYVRFR VDGQTYEYND LPKLKKTEKH       240
     DIDVVIDRLR ARPDMQQRLA ESFEAALRLA EGRAIALELG AEGVADKEHL FNAKFACPIC       300
     HYSLSELEPR LFSFNSPVGA CPSCDGLGHR EVFDPARVVA FPSLSIASGA IKGWDRRNGY       360
     YFSMIESVAK HYKFDVDAPF ESLPASVQQV LLNGSAAEEI KFNYTMESGN FAGKKLTKKH       420
     PFEGIIPNMT RRYRETDSVM VREDLARFRN LQPCPDCGGS RLRREARNVF LVDESARPAD       480
     GGEPPRMAIF ELSHLTLRDS LAWFQTLKLR GAKADIADKV VREIGLRLKF LNDVGLNYLS       540
     LDRSAETLSG GEAQRIRLAS QIGSGLTGVM YVLDEPSIGL HQRDNDRLIG TLKHLRDIGN       600
     SVIVVEHDED MIHAADHVID MGPGAGVHGG RVMAQGTYAE VSANPDSLTG QYLSGTKKIE       660
     VPKHRTAWLP AVKKPAFNEG KKPSRFPQSP AAERRAAREA AHIASQTDLQ EIRVVGATGN       720
     NLKNVSVAFP VGLLTCVTGV SGSGKSTLVN DTLYTAVART LYRAHEEPAE HESVEGIEYF       780
     DKVINVDQSP IGRTPRSNPA TYTGLFTPIR ELMAETNTAR ERGYGPGRFS FNVAGGRCEA       840
     CQGDGVVKVE MHFLPDVYVP CEVCHGQRYN RETLEVQYKG KNIAQILEMT VETAHEFLKA       900
     VPTIERKLRT LLDVGLSYIK LGQSATTLSG GEAQRVKLAL ELSKRDTGRT LYILDEPTTG       960
     LHFADIELLL KVLHQLRDAG NTIVVIEHNL DVIKTADWLI DMGPEGGAGG GTVVGEGTPE      1020
     DIAANEASHT GRYLKRLL                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page