(data stored in SCRATCH zone)

EMBL: CP002417.PE398

CP002417.PE398       Location/Qualifiers
FT   CDS             427491..429479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0399"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="KEGG: vap:Vapar_0380 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34621"
FT                   /db_xref="GOA:E6V3D1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34621.1"
FT                   /translation="MNVPMVRELRAWFFEGLSKYRAAPLWANVVLVVSLALLALMIVFF
FT                   GGSSAAPGVPATRITHADWQVTEAPGFREPSIVMDSRALPDTWQSIELPLSLPIALLRQ
FT                   TDDRFIASATRTTWLRVAVHDLPVTTGPLALYGVRIKTDGTIAVYADGRLVHRDQENGP
FT                   LWNSTRTPLWVVIEKTPDAVPLKEILIRLEHTRNAQVAVSSLWLGPVDSLKDRYNKRLW
FT                   FQQDLPAMLGAAFMAVGLFALFVWFRRRHETGYLLFFNLATTSFLRSLHFYVSLPVAND
FT                   WFAWLTVNSLFWLVAVVHFALRQLHGRPLQWLTYAVVGWTALIGVLTLPGLGILTNTPQ
FT                   VTPLIYVGAAAMGAAVALVGGISAWRRSNEGRLVAVGIGVCVLLGLSDWLLQNNFANPE
FT                   GWYLGSYTNAVTFAVFGTLMYRRYVNAIAEVELVNASLAERLQAREAELEQSHRRLREV
FT                   EKRQTISDERQRLMQDMHDGLGSSLISAIRSVENGRLSDEKVSHILRSCLDDLKLTIDS
FT                   MEPLEEDLLLLLATLRYRLGPRLEGSGVALRWEVQEIPPLDWLDPTSALHILRIVQESI
FT                   ANILRHTRATEIRVGTAPEAEGVRVTIEDNGQGFDVDKAMAEAGGRGMQNQLRRAQAIG
FT                   GGVSWRSGPTGTLFTLWLPLQRKPRKA"
     MNVPMVRELR AWFFEGLSKY RAAPLWANVV LVVSLALLAL MIVFFGGSSA APGVPATRIT        60
     HADWQVTEAP GFREPSIVMD SRALPDTWQS IELPLSLPIA LLRQTDDRFI ASATRTTWLR       120
     VAVHDLPVTT GPLALYGVRI KTDGTIAVYA DGRLVHRDQE NGPLWNSTRT PLWVVIEKTP       180
     DAVPLKEILI RLEHTRNAQV AVSSLWLGPV DSLKDRYNKR LWFQQDLPAM LGAAFMAVGL       240
     FALFVWFRRR HETGYLLFFN LATTSFLRSL HFYVSLPVAN DWFAWLTVNS LFWLVAVVHF       300
     ALRQLHGRPL QWLTYAVVGW TALIGVLTLP GLGILTNTPQ VTPLIYVGAA AMGAAVALVG       360
     GISAWRRSNE GRLVAVGIGV CVLLGLSDWL LQNNFANPEG WYLGSYTNAV TFAVFGTLMY       420
     RRYVNAIAEV ELVNASLAER LQAREAELEQ SHRRLREVEK RQTISDERQR LMQDMHDGLG       480
     SSLISAIRSV ENGRLSDEKV SHILRSCLDD LKLTIDSMEP LEEDLLLLLA TLRYRLGPRL       540
     EGSGVALRWE VQEIPPLDWL DPTSALHILR IVQESIANIL RHTRATEIRV GTAPEAEGVR       600
     VTIEDNGQGF DVDKAMAEAG GRGMQNQLRR AQAIGGGVSW RSGPTGTLFT LWLPLQRKPR       660
     KA                                                                      662
//

If you have problems or comments...

PBIL Back to PBIL home page