(data stored in SCRATCH zone)

EMBL: CP002417.PE399

CP002417.PE399       Location/Qualifiers
FT   CDS             complement(429489..429917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0400"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: vap:Vapar_0381 glutathione-dependent
FT                   formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34622"
FT                   /db_xref="GOA:E6V3D2"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D2"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ADU34622.1"
FT                   /translation="MTSPGTTTVRSLAGKCLCGAVHYTVADEFTYALNCHCADCRRATG
FT                   SAFKPFAGIERHKLAITQGADTLLIHGEEDAGDIHCGKCGSFLYSVVRDGMFVHVTLGT
FT                   LVDDPSIRPSAHIFVGSKAPWFAINDDLPQHQGHAGAD"
     MTSPGTTTVR SLAGKCLCGA VHYTVADEFT YALNCHCADC RRATGSAFKP FAGIERHKLA        60
     ITQGADTLLI HGEEDAGDIH CGKCGSFLYS VVRDGMFVHV TLGTLVDDPS IRPSAHIFVG       120
     SKAPWFAIND DLPQHQGHAG AD                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page