(data stored in ACNUC1104 zone)

EMBL: CP002417.PE4

CP002417.PE4         Location/Qualifiers
FT   CDS             complement(6085..6729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_0003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34227"
FT                   /db_xref="GOA:E6UXN3"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN3"
FT                   /inference="similar to AA sequence:KEGG:Pnap_0003"
FT                   /protein_id="ADU34227.1"
FT                   /translation="MNGTDDHDPLPERREAMTAWERGLRPKRDRHWALWLALAALLVFL
FT                   LFRGAEWLLAQRASSQPAQQRPTAPPAPIGRAAPVPPSPSLAPAPPDTFEVTKCLTPSG
FT                   KAAYSDGPCPPGSRATTVRLRRDVNIADGMSISEREASNRNNTAVAEQQQQYERQVARN
FT                   VDSAMAECSQLDESVKRLDAAARQPQDVYSQDRLRSERHAARDRRFRLGCQ"
     MNGTDDHDPL PERREAMTAW ERGLRPKRDR HWALWLALAA LLVFLLFRGA EWLLAQRASS        60
     QPAQQRPTAP PAPIGRAAPV PPSPSLAPAP PDTFEVTKCL TPSGKAAYSD GPCPPGSRAT       120
     TVRLRRDVNI ADGMSISERE ASNRNNTAVA EQQQQYERQV ARNVDSAMAE CSQLDESVKR       180
     LDAAARQPQD VYSQDRLRSE RHAARDRRFR LGCQ                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page