(data stored in ACNUC1104 zone)

EMBL: CP002417.PE400

CP002417.PE400       Location/Qualifiers
FT   CDS             complement(429945..430658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0401"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   vap:Vapar_0382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34623"
FT                   /db_xref="GOA:E6V3D3"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D3"
FT                   /inference="protein motif:PFAM:PF01709"
FT                   /protein_id="ADU34623.1"
FT                   /translation="MGAQWKAKHKDLAANAKGRLFGKLAKEIMMAARNGADPASNSRLR
FT                   LVVEQARKVSMPKDTLDRAIKKGAGLTGEAVHFEHVIYEGFAPHRVPVMVECLTDNVNR
FT                   TAPEMRVLFRKGQLGTSGSVSWDFDHVGMIEAEPANATADAEVAAIEAGAQDFEPAGES
FT                   NATVFLTDPTDLDLVSRALPAQGFTVLSAKLGYKPKNPVDPASLSAADLEEVEVFLAAI
FT                   DANDDVQNVYVGLAG"
     MGAQWKAKHK DLAANAKGRL FGKLAKEIMM AARNGADPAS NSRLRLVVEQ ARKVSMPKDT        60
     LDRAIKKGAG LTGEAVHFEH VIYEGFAPHR VPVMVECLTD NVNRTAPEMR VLFRKGQLGT       120
     SGSVSWDFDH VGMIEAEPAN ATADAEVAAI EAGAQDFEPA GESNATVFLT DPTDLDLVSR       180
     ALPAQGFTVL SAKLGYKPKN PVDPASLSAA DLEEVEVFLA AIDANDDVQN VYVGLAG          237
//

If you have problems or comments...

PBIL Back to PBIL home page