(data stored in ACNUC1104 zone)

EMBL: CP002417.PE404

CP002417.PE404       Location/Qualifiers
FT   CDS             433064..433642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0405"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: ajs:Ajs_2319 BioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34627"
FT                   /db_xref="GOA:E6V3D7"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D7"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADU34627.1"
FT                   /translation="MTTTGSITSSRSLSYIALFAALMAVFGLIPKVDLPFGVPITLQSL
FT                   GVMLAGCLLGPRRGFFAIALFLLAVALGLPLLPGGRGGLAVFVAPAGGFLFGWMFGAFA
FT                   CGLLMRRMAGATGKGLLAAAFLSSVVGGIVVVYAFGIVGLSLIAHMSLTQAALAMLVFI
FT                   PGDLIKCGICAMLVQTVMRGMPSWRLDRD"
     MTTTGSITSS RSLSYIALFA ALMAVFGLIP KVDLPFGVPI TLQSLGVMLA GCLLGPRRGF        60
     FAIALFLLAV ALGLPLLPGG RGGLAVFVAP AGGFLFGWMF GAFACGLLMR RMAGATGKGL       120
     LAAAFLSSVV GGIVVVYAFG IVGLSLIAHM SLTQAALAML VFIPGDLIKC GICAMLVQTV       180
     MRGMPSWRLD RD                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page