(data stored in SCRATCH zone)

EMBL: CP002417.PE405

CP002417.PE405       Location/Qualifiers
FT   CDS             complement(433649..434116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aas:Aasi_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34628"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D8"
FT                   /inference="similar to AA sequence:KEGG:Aasi_0143"
FT                   /protein_id="ADU34628.1"
FT                   /translation="METTPLPPLAWGMPDTVFDLLEGVWDLDRVIEGKATMAGTARFVR
FT                   LDAGQLKYREEGRIQLPNGQAFDGHREYVFERSPKGFSVFFAEVPPRLFHDIAIVREGD
FT                   ELVGSAGHLCVADQYDSVYRFRADGSFVIEHLVKGPRKDYLSRTVFKRRGL"
     METTPLPPLA WGMPDTVFDL LEGVWDLDRV IEGKATMAGT ARFVRLDAGQ LKYREEGRIQ        60
     LPNGQAFDGH REYVFERSPK GFSVFFAEVP PRLFHDIAIV REGDELVGSA GHLCVADQYD       120
     SVYRFRADGS FVIEHLVKGP RKDYLSRTVF KRRGL                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page