(data stored in ACNUC1104 zone)

EMBL: CP002417.PE406

CP002417.PE406       Location/Qualifiers
FT   CDS             434374..434754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0407"
FT                   /product="SNF2 superfamily protein"
FT                   /note="KEGG: vap:Vapar_0383 SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34629"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3D9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0383"
FT                   /protein_id="ADU34629.1"
FT                   /translation="MTASKILSAVAVALMAVAGAAHAESYDGVHQLTSAASRADVASQA
FT                   VVAAHSANPYATGANAGPAQVFVSSTSRAAVRSEAVAAAHSADPYAEGASAGVAPLVAS
FT                   TVDRNAVRAAARAAARGDALPL"
     MTASKILSAV AVALMAVAGA AHAESYDGVH QLTSAASRAD VASQAVVAAH SANPYATGAN        60
     AGPAQVFVSS TSRAAVRSEA VAAAHSADPY AEGASAGVAP LVASTVDRNA VRAAARAAAR       120
     GDALPL                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page