(data stored in ACNUC1104 zone)

EMBL: CP002417.PE409

CP002417.PE409       Location/Qualifiers
FT   CDS             436732..438597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0410"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; glycosyl transferase
FT                   group 1; KEGG: mxa:MXAN_4997 VanW-like domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34632"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E2"
FT                   /inference="protein motif:PFAM:PF04294"
FT                   /protein_id="ADU34632.1"
FT                   /translation="MAQARPVGVSVRAWQPPRRIDAIDFWLRSRLLASAHALREALRPS
FT                   ARRWHGDAHALADAPVLAQYRTPLWSDGRADEFPLVAGKVQNLRVARRAFDAIEVPAGE
FT                   VLSFWRQLGRPSASRGFVQGRELRGGCVVPTLAGGLCQLSNALATVAARAGLELVERHG
FT                   HTARIEQAADAAGDAVDATVFWNYVDLKVRAKHAWRLEVELTSDELVLRIRARSPIAMP
FT                   AVPMALRRASEEGASAALPLARGCLSCDQTACFRHRLLPAVAQQGRTAVLLDAWTPEFA
FT                   RYLAAHHTGADRMQPVPLRLAFWRAGPATGRHREAVADGAASVQSPWWASLRSTVWQRL
FT                   WARHAGRRQGSLIGGQRWLALAFAARLKPEHTQLVIDQALLPHLQQLGALDGRRVTVLA
FT                   SALPMAEIERRLDAAAQRWPGDATLRDFRADAALVQAEAAALARVAAVVTPHAEAATHL
FT                   AAMAPRAALFRLDWVLPAARDIDAACDAPPLIVFAASALARKGARELAAALQGWPCRLR
FT                   VLGSPSDDAQLWRGIGSVEHMHWRGDGLNGARVVVLPAHIEHAPRALLRALAAGVPVVA
FT                   SSACGLAGLSGVREVAAGDVEGLRAALKNACNADDGNNKNDESAS"
     MAQARPVGVS VRAWQPPRRI DAIDFWLRSR LLASAHALRE ALRPSARRWH GDAHALADAP        60
     VLAQYRTPLW SDGRADEFPL VAGKVQNLRV ARRAFDAIEV PAGEVLSFWR QLGRPSASRG       120
     FVQGRELRGG CVVPTLAGGL CQLSNALATV AARAGLELVE RHGHTARIEQ AADAAGDAVD       180
     ATVFWNYVDL KVRAKHAWRL EVELTSDELV LRIRARSPIA MPAVPMALRR ASEEGASAAL       240
     PLARGCLSCD QTACFRHRLL PAVAQQGRTA VLLDAWTPEF ARYLAAHHTG ADRMQPVPLR       300
     LAFWRAGPAT GRHREAVADG AASVQSPWWA SLRSTVWQRL WARHAGRRQG SLIGGQRWLA       360
     LAFAARLKPE HTQLVIDQAL LPHLQQLGAL DGRRVTVLAS ALPMAEIERR LDAAAQRWPG       420
     DATLRDFRAD AALVQAEAAA LARVAAVVTP HAEAATHLAA MAPRAALFRL DWVLPAARDI       480
     DAACDAPPLI VFAASALARK GARELAAALQ GWPCRLRVLG SPSDDAQLWR GIGSVEHMHW       540
     RGDGLNGARV VVLPAHIEHA PRALLRALAA GVPVVASSAC GLAGLSGVRE VAAGDVEGLR       600
     AALKNACNAD DGNNKNDESA S                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page