(data stored in SCRATCH zone)

EMBL: CP002417.PE412

CP002417.PE412       Location/Qualifiers
FT   CDS             441352..442452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0413"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /note="TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   KEGG: vap:Vapar_0387 tRNA-specific 2-thiouridylase MnmA"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34635"
FT                   /db_xref="GOA:E6V3E5"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3E5"
FT                   /inference="protein motif:TFAM:TIGR00420"
FT                   /protein_id="ADU34635.1"
FT                   /translation="MAKQRIVVGLSGGVDSAVTAHLLKQQGHEVVGIFMKNWEDDDDSE
FT                   YCSSNIDFIDAASVADVLGIEIEHVNFAADYKDRVFAEFLREYKAGRTPNPDVLCNAEI
FT                   KFKAFLDHAMRLGAEKIATGHYARVRHNEVTGRHELLKGLDPSKDQSYFLHRLNQAQLS
FT                   KTLFPVGELHKTEVRRIAEEIGLPNAKKKDSTGICFIGERPFRDFLNRYISKEPGPIKD
FT                   DRGRKLGEHQGLSFYTLGQRQGLGIGGVKEKGAQRGSGDHSPWFVARKDIEKNTLWVVQ
FT                   GHDHPWLLSSALNADDASWVSGEAPAAGSYGSKARYRQADAGCELSDDANGAFSLRFGA
FT                   PQWAVTPGQSAVLYDGERCLGGGVIV"
     MAKQRIVVGL SGGVDSAVTA HLLKQQGHEV VGIFMKNWED DDDSEYCSSN IDFIDAASVA        60
     DVLGIEIEHV NFAADYKDRV FAEFLREYKA GRTPNPDVLC NAEIKFKAFL DHAMRLGAEK       120
     IATGHYARVR HNEVTGRHEL LKGLDPSKDQ SYFLHRLNQA QLSKTLFPVG ELHKTEVRRI       180
     AEEIGLPNAK KKDSTGICFI GERPFRDFLN RYISKEPGPI KDDRGRKLGE HQGLSFYTLG       240
     QRQGLGIGGV KEKGAQRGSG DHSPWFVARK DIEKNTLWVV QGHDHPWLLS SALNADDASW       300
     VSGEAPAAGS YGSKARYRQA DAGCELSDDA NGAFSLRFGA PQWAVTPGQS AVLYDGERCL       360
     GGGVIV                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page