(data stored in ACNUC1104 zone)

EMBL: CP002417.PE417

CP002417.PE417       Location/Qualifiers
FT   CDS             445782..446114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0418"
FT                   /product="NAD(P) transhydrogenase, subunit alpha part 2"
FT                   /note="KEGG: vap:Vapar_6043 NAD(P) transhydrogenase,
FT                   subunit alpha part 2"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34640"
FT                   /db_xref="GOA:E6V3F0"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_6043"
FT                   /protein_id="ADU34640.1"
FT                   /translation="MDPVSHTVINLIIFVLAIYVGYHVVWTVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTTTPLGKTMGVLAVALAAVNVFGGFLVTRRMLEMFKKKDKKAAAPKA
FT                   EEGASK"
     MDPVSHTVIN LIIFVLAIYV GYHVVWTVTP ALHTPLMAVT NAISAIVIVG AMLAAALTTT        60
     PLGKTMGVLA VALAAVNVFG GFLVTRRMLE MFKKKDKKAA APKAEEGASK                  110
//

If you have problems or comments...

PBIL Back to PBIL home page