(data stored in SCRATCH zone)

EMBL: CP002417.PE421

CP002417.PE421       Location/Qualifiers
FT   CDS             450455..451369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0422"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0396
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34644"
FT                   /db_xref="GOA:E6V3F4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34644.1"
FT                   /translation="MMNTTSTPTIPTTGASTAPPGPWREFWTAFSANRGAVIGLVTIVV
FT                   LLLVALFAPWIAPHAPNETNSAVFLQPPAWQQGGTWSYLLGTDAIGRDILSRLMYGARL
FT                   SLSIGVAVVALSVVAGVVLGLIAGFFRGVLEIAIMRLMDIVLTLPSLLLAIVIVAILGP
FT                   GLVNAMLAVAIVVLPHYVRITRAAVIAEVSRDYVTAARVSGAGTLRLMFREVLPNCAAP
FT                   LIVQASLGISTAILDAAALGFLGLGAQPPSPEWGTMLADAREFVLRAWWVVTFPGLAIL
FT                   AAVLAFNLLGDGLRDALDPKLKR"
     MMNTTSTPTI PTTGASTAPP GPWREFWTAF SANRGAVIGL VTIVVLLLVA LFAPWIAPHA        60
     PNETNSAVFL QPPAWQQGGT WSYLLGTDAI GRDILSRLMY GARLSLSIGV AVVALSVVAG       120
     VVLGLIAGFF RGVLEIAIMR LMDIVLTLPS LLLAIVIVAI LGPGLVNAML AVAIVVLPHY       180
     VRITRAAVIA EVSRDYVTAA RVSGAGTLRL MFREVLPNCA APLIVQASLG ISTAILDAAA       240
     LGFLGLGAQP PSPEWGTMLA DAREFVLRAW WVVTFPGLAI LAAVLAFNLL GDGLRDALDP       300
     KLKR                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page