(data stored in ACNUC1104 zone)

EMBL: CP002417.PE427

CP002417.PE427       Location/Qualifiers
FT   CDS             complement(457539..458525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0428"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="KEGG: vap:Vapar_0401 magnesium and cobalt transport
FT                   protein CorA; TIGRFAM: magnesium and cobalt transport
FT                   protein CorA; PFAM: Mg2 transporter protein CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34650"
FT                   /db_xref="GOA:E6V3G0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G0"
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /protein_id="ADU34650.1"
FT                   /translation="MLNIFTLANGRLVQEEIESLEELSKFQPIWVDLESPTLEEKRWIK
FT                   QYYGLSIPEDAMDEDIEESARFYEEDNGELHIRSDFLIDDDEDPRTVRVAFILNQHNTD
FT                   LRSRGVLFSIHDEDVPVFRLLRMRARRAPGLIEDAKEVMLKLFDADAEYSADTLENIYD
FT                   ELEVAGKKVLSGNVTDELAGEVLGLIARQEDLNGRIRRNVMDTRRAVSFMMRSKMLNAE
FT                   QFEEARQILRDIESLDNHTAFLFDKINFLMDATVGFININQNKTIKIFSVASVALLPPT
FT                   LIASIYGMNFKFMPELDWAMGYPYAIVLMAASALVPMWYFRRRGWLK"
     MLNIFTLANG RLVQEEIESL EELSKFQPIW VDLESPTLEE KRWIKQYYGL SIPEDAMDED        60
     IEESARFYEE DNGELHIRSD FLIDDDEDPR TVRVAFILNQ HNTDLRSRGV LFSIHDEDVP       120
     VFRLLRMRAR RAPGLIEDAK EVMLKLFDAD AEYSADTLEN IYDELEVAGK KVLSGNVTDE       180
     LAGEVLGLIA RQEDLNGRIR RNVMDTRRAV SFMMRSKMLN AEQFEEARQI LRDIESLDNH       240
     TAFLFDKINF LMDATVGFIN INQNKTIKIF SVASVALLPP TLIASIYGMN FKFMPELDWA       300
     MGYPYAIVLM AASALVPMWY FRRRGWLK                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page