(data stored in ACNUC1104 zone)

EMBL: CP002417.PE428

CP002417.PE428       Location/Qualifiers
FT   CDS             458738..460855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0429"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: vap:Vapar_0402
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34651"
FT                   /db_xref="GOA:E6V3G1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G1"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADU34651.1"
FT                   /translation="MQTAAPPVISAAPKTQAERLAAALATLNDDQRAAVEHGVGAAVAD
FT                   DHRPLLVIAGAGSGKTSTLAHRVAHLIADGVDPQRLLLLTFSRRAAQEMERRAGQVLAK
FT                   VLGLKSERPPALPWAGTFHGIGARLLREYAQQIGLDENFTIHDRGDAEDLMGLVRHELG
FT                   LSSTVNRFPRKGTCLSIYSRCVNTRASVAEVLKEAFPWCGEWEAELKTLFGAYVEAKQQ
FT                   QNVLDYDDLLLYWAEMVAEPALAEAVGARFDHVLVDEYQDTNLLQASILLAMKPDGRGV
FT                   TVVGDDAQSIYSFRGATVRNILDFPSQFSREARVVTLERNYRSTQPILDVSNRVIAQAA
FT                   ERHAKTLWTDKPSAGKPQLVLVPDEAGQARWVADKVLAHREGGLALKSQAVLFRTSSHS
FT                   AALELELARRNIPFVKFGGLKFLEASHVKDLLAVLRFAENPRGRMAGFRVTQLIPGIGP
FT                   VTGTRLLDAMDQAADPAAAVRDFVPPSAAREQWAGFAEAYAALRAPSLAWPADVELAMG
FT                   WYLPHLERLYDDTSGVRRQDVEQLVRLAAGYGSRERFLTELTLDPPEATSDRPGPPLLD
FT                   EDYLILSTIHSAKGQEWNSVHVLNVVDGCLPADVAQSAHELEEERRLLYVAMTRARDHL
FT                   HLLVPQRFYITQQAVRGDRHLYANRTRFITESDLAGFEQQTWPPPPVQPPAVPPPAAVI
FT                   DLRNRMRAAWR"
     MQTAAPPVIS AAPKTQAERL AAALATLNDD QRAAVEHGVG AAVADDHRPL LVIAGAGSGK        60
     TSTLAHRVAH LIADGVDPQR LLLLTFSRRA AQEMERRAGQ VLAKVLGLKS ERPPALPWAG       120
     TFHGIGARLL REYAQQIGLD ENFTIHDRGD AEDLMGLVRH ELGLSSTVNR FPRKGTCLSI       180
     YSRCVNTRAS VAEVLKEAFP WCGEWEAELK TLFGAYVEAK QQQNVLDYDD LLLYWAEMVA       240
     EPALAEAVGA RFDHVLVDEY QDTNLLQASI LLAMKPDGRG VTVVGDDAQS IYSFRGATVR       300
     NILDFPSQFS REARVVTLER NYRSTQPILD VSNRVIAQAA ERHAKTLWTD KPSAGKPQLV       360
     LVPDEAGQAR WVADKVLAHR EGGLALKSQA VLFRTSSHSA ALELELARRN IPFVKFGGLK       420
     FLEASHVKDL LAVLRFAENP RGRMAGFRVT QLIPGIGPVT GTRLLDAMDQ AADPAAAVRD       480
     FVPPSAAREQ WAGFAEAYAA LRAPSLAWPA DVELAMGWYL PHLERLYDDT SGVRRQDVEQ       540
     LVRLAAGYGS RERFLTELTL DPPEATSDRP GPPLLDEDYL ILSTIHSAKG QEWNSVHVLN       600
     VVDGCLPADV AQSAHELEEE RRLLYVAMTR ARDHLHLLVP QRFYITQQAV RGDRHLYANR       660
     TRFITESDLA GFEQQTWPPP PVQPPAVPPP AAVIDLRNRM RAAWR                       705
//

If you have problems or comments...

PBIL Back to PBIL home page