(data stored in ACNUC1104 zone)

EMBL: CP002417.PE429

CP002417.PE429       Location/Qualifiers
FT   CDS             461177..461506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0430"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="KEGG: vap:Vapar_0403 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34652"
FT                   /db_xref="GOA:E6V3G2"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G2"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADU34652.1"
FT                   /translation="MNLTISGHHLDVTPALRTYVTSKLDRITRHFDQVVDVKVILTVEK
FT                   QKEKERRQRAECNIHVKGNDMFAESSHADLYAAVDELVDKLDRQVVRHKDRLQDHHHVA
FT                   PKRVM"
     MNLTISGHHL DVTPALRTYV TSKLDRITRH FDQVVDVKVI LTVEKQKEKE RRQRAECNIH        60
     VKGNDMFAES SHADLYAAVD ELVDKLDRQV VRHKDRLQDH HHVAPKRVM                   109
//

If you have problems or comments...

PBIL Back to PBIL home page