(data stored in SCRATCH zone)

EMBL: CP002417.PE43

CP002417.PE43        Location/Qualifiers
FT   CDS             complement(45692..46177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0043"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: vap:Vapar_0038
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34266"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS2"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADU34266.1"
FT                   /translation="MARIAQRLAALGLVLPPTVTPPPGVVLPFQFVRLIGRRAIVSGHG
FT                   PLNADGSIASPLGKLGREVSVDQGYAAARLTALAMLGSLQRALGDLDRITAWTRVFGMV
FT                   ASAPGFDKQPAVINGFSDLILDLFGPDVGAHARSAVGMAELPFNIPVEIEGEVEFDA"
     MARIAQRLAA LGLVLPPTVT PPPGVVLPFQ FVRLIGRRAI VSGHGPLNAD GSIASPLGKL        60
     GREVSVDQGY AAARLTALAM LGSLQRALGD LDRITAWTRV FGMVASAPGF DKQPAVINGF       120
     SDLILDLFGP DVGAHARSAV GMAELPFNIP VEIEGEVEFD A                           161
//

If you have problems or comments...

PBIL Back to PBIL home page