(data stored in ACNUC1104 zone)

EMBL: CP002417.PE436

CP002417.PE436       Location/Qualifiers
FT   CDS             466092..466562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0437"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   vap:Vapar_0410 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34659"
FT                   /db_xref="GOA:E6V4B3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B3"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ADU34659.1"
FT                   /translation="MAFGRTSLGSSAAGGGRATGAGGQRPLSDINVTPLVDVMLVLLVI
FT                   FIITAPLMASSIKLDLPQTDAGQPNDTPKFVSLAVDASGKVFLNDKPVTHEELAAQLEK
FT                   SAADSKDTEVQLRADQTVPYGKVVALMGIANKAGLSRIGFVTEAEAPPEKPR"
     MAFGRTSLGS SAAGGGRATG AGGQRPLSDI NVTPLVDVML VLLVIFIITA PLMASSIKLD        60
     LPQTDAGQPN DTPKFVSLAV DASGKVFLND KPVTHEELAA QLEKSAADSK DTEVQLRADQ       120
     TVPYGKVVAL MGIANKAGLS RIGFVTEAEA PPEKPR                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page