(data stored in SCRATCH zone)

EMBL: CP002417.PE439

CP002417.PE439       Location/Qualifiers
FT   CDS             complement(470726..472033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0440"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   KEGG: vap:Vapar_0413 glucose-1-phosphate
FT                   adenylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34662"
FT                   /db_xref="GOA:E6V4B6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B6"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ADU34662.1"
FT                   /translation="MDNKLGTPPSQEPLQAHQLVRRTIALVLAGGRGSRLKQLTDRRAK
FT                   PAVYFGGKFRIIDFALSNCLNSGIRRMAVVTQYKSHSLMRHLQRGWSFLRAELNEMVDV
FT                   LPAQQRVGDEHWYRGTADAVFQNLDIIQTRSTKHDYVVVLAGDHIYKMDYSIMVKDHAE
FT                   RGLGCTVGCIEVPRMEATAFGVMAIDDGRQITAFLEKPADPPAMPGHPDVALASMGIYV
FT                   FDSNYLYQLLEEDAANPDSSHDFGKDIIPRAVAQGRALAHPFGMSCVTRASRGPDAKAY
FT                   WRDVGTIDAFWAANLDLASITPELDIYDTDWPIWTYQRQLPPAKFVLDRDGKHGMTVNT
FT                   IVSGGCIVSGSKVSSSVLFSGVRIHSFCEINEAVLLPDVEVGRGARLSKVVIDRGCVIP
FT                   DDMVIGEDAAADAARFERTETGVVLVTREMLKRLTA"
     MDNKLGTPPS QEPLQAHQLV RRTIALVLAG GRGSRLKQLT DRRAKPAVYF GGKFRIIDFA        60
     LSNCLNSGIR RMAVVTQYKS HSLMRHLQRG WSFLRAELNE MVDVLPAQQR VGDEHWYRGT       120
     ADAVFQNLDI IQTRSTKHDY VVVLAGDHIY KMDYSIMVKD HAERGLGCTV GCIEVPRMEA       180
     TAFGVMAIDD GRQITAFLEK PADPPAMPGH PDVALASMGI YVFDSNYLYQ LLEEDAANPD       240
     SSHDFGKDII PRAVAQGRAL AHPFGMSCVT RASRGPDAKA YWRDVGTIDA FWAANLDLAS       300
     ITPELDIYDT DWPIWTYQRQ LPPAKFVLDR DGKHGMTVNT IVSGGCIVSG SKVSSSVLFS       360
     GVRIHSFCEI NEAVLLPDVE VGRGARLSKV VIDRGCVIPD DMVIGEDAAA DAARFERTET       420
     GVVLVTREML KRLTA                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page