(data stored in ACNUC1104 zone)

EMBL: CP002417.PE44

CP002417.PE44        Location/Qualifiers
FT   CDS             complement(46247..47350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0044"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   vap:Vapar_0039 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34267"
FT                   /db_xref="GOA:E6UXS3"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS3"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADU34267.1"
FT                   /translation="MSTLFDPVQAGDLKLANRIVMAPLTRNRSPNAVPPDLAVTYYAQR
FT                   ATAGLLITEATAISHQGQGYSDVPGLYGTEQLDSWKRVTEAVHAKGGKIVVQLWHVGRV
FT                   SHTELQPDGGKPVAPSAITAKTKTVLIKDGVPTFVETSEPRALDAAELPGIVHAYAVAA
FT                   RSAVETAGFDGVEVHGANGYLLDQFLKDGSNKRTDDYGGSIQNRARLLLEVTRAVVDAV
FT                   GGGKTGIRLSPVTPANDVHDSDPQPLFTYVVKQLAQLNLAYIHIIEGATGGPREIEDRP
FT                   FDYEALKAAYREAGGKGAWMVNNGYDKPLADEAVKEGDDLVAFGKPFISNPDLVRRLRE
FT                   NAPLNELDKATMYGGGAKGYTDYPALG"
     MSTLFDPVQA GDLKLANRIV MAPLTRNRSP NAVPPDLAVT YYAQRATAGL LITEATAISH        60
     QGQGYSDVPG LYGTEQLDSW KRVTEAVHAK GGKIVVQLWH VGRVSHTELQ PDGGKPVAPS       120
     AITAKTKTVL IKDGVPTFVE TSEPRALDAA ELPGIVHAYA VAARSAVETA GFDGVEVHGA       180
     NGYLLDQFLK DGSNKRTDDY GGSIQNRARL LLEVTRAVVD AVGGGKTGIR LSPVTPANDV       240
     HDSDPQPLFT YVVKQLAQLN LAYIHIIEGA TGGPREIEDR PFDYEALKAA YREAGGKGAW       300
     MVNNGYDKPL ADEAVKEGDD LVAFGKPFIS NPDLVRRLRE NAPLNELDKA TMYGGGAKGY       360
     TDYPALG                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page