(data stored in ACNUC1104 zone)

EMBL: CP002417.PE440

CP002417.PE440       Location/Qualifiers
FT   CDS             complement(472122..474212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0441"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; KEGG: vap:Vapar_0414 glycogen debranching
FT                   enzyme GlgX; SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34663"
FT                   /db_xref="GOA:E6V4B7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B7"
FT                   /inference="protein motif:TFAM:TIGR02100"
FT                   /protein_id="ADU34663.1"
FT                   /translation="MLSPGTPFPLGATPSKEGVNFALAAPTAESVELCLFDSTGQNEQQ
FT                   RLQLPACTDGIWHGLLPSGHEGLVYGYRVHGPWAPHEGQRFNPAKLLLDPYAREIVGRY
FT                   NGSDLFLGHDPANPDQRDTRDNGTVALKGRVTTASRSNATPPGHARIAATDRVLYELHV
FT                   RGQTRLHPGVPAPLRGTYAGLAEPAVLDHLQRLGVTTLSLMPVQHRADEQRLLAMGLSN
FT                   YWGYNTIGWFAPEARYWSGRPGTTPASEFRAMADAVHARGMELVIDVVYNHSAESDEVG
FT                   PTLSMRGIDNALYYHLREDDRALYENWTGTGNCLNLREPRVLQLVMDSLRFWACEMGVD
FT                   GFRFDLAPVLGRDAKTGFDARAPFFAAIAQDPVLSRTLLIAEPWDIGPGGYRLGEFPSG
FT                   WLEWNDRYRDTQRGFWLRQGRDDASGLGDFAHRFTASSTQFAHHGRAPTASVNFITAHD
FT                   GFTLRDLVSYEERHNLANGENNRDGHGHNLSNNCGVEGPSDDAGVLAKRSRLQRALLAV
FT                   LLLSQGTPMLLAGDELGHSQQGNNNAYCQDNETTWLAWIGASDPASDMARTSDFVARLS
FT                   ALRREAPVLRSTRWWPADPPEGAPAIRWLRPDGQPMTPHDWHAGTALAILFDNNESAES
FT                   KDAGAWLVLVNAGAETVNFTLLPGNWRHRLSTDPGHDHDASPQALGDAVEVSCSSIRIA
FT                   RT"
     MLSPGTPFPL GATPSKEGVN FALAAPTAES VELCLFDSTG QNEQQRLQLP ACTDGIWHGL        60
     LPSGHEGLVY GYRVHGPWAP HEGQRFNPAK LLLDPYAREI VGRYNGSDLF LGHDPANPDQ       120
     RDTRDNGTVA LKGRVTTASR SNATPPGHAR IAATDRVLYE LHVRGQTRLH PGVPAPLRGT       180
     YAGLAEPAVL DHLQRLGVTT LSLMPVQHRA DEQRLLAMGL SNYWGYNTIG WFAPEARYWS       240
     GRPGTTPASE FRAMADAVHA RGMELVIDVV YNHSAESDEV GPTLSMRGID NALYYHLRED       300
     DRALYENWTG TGNCLNLREP RVLQLVMDSL RFWACEMGVD GFRFDLAPVL GRDAKTGFDA       360
     RAPFFAAIAQ DPVLSRTLLI AEPWDIGPGG YRLGEFPSGW LEWNDRYRDT QRGFWLRQGR       420
     DDASGLGDFA HRFTASSTQF AHHGRAPTAS VNFITAHDGF TLRDLVSYEE RHNLANGENN       480
     RDGHGHNLSN NCGVEGPSDD AGVLAKRSRL QRALLAVLLL SQGTPMLLAG DELGHSQQGN       540
     NNAYCQDNET TWLAWIGASD PASDMARTSD FVARLSALRR EAPVLRSTRW WPADPPEGAP       600
     AIRWLRPDGQ PMTPHDWHAG TALAILFDNN ESAESKDAGA WLVLVNAGAE TVNFTLLPGN       660
     WRHRLSTDPG HDHDASPQAL GDAVEVSCSS IRIART                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page