(data stored in SCRATCH zone)

EMBL: CP002417.PE441

CP002417.PE441       Location/Qualifiers
FT   CDS             complement(474206..475027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34664"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B8"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0518"
FT                   /protein_id="ADU34664.1"
FT                   /translation="MGLESSFFPRPGLAPAGDLLSFASPKERKQRKGDPAVCVPPLRCG
FT                   QPAVLAFRGVRRTRFAQTAAALIRETLRSSAHTEGLWGPHTPSLRSAAPSGLRFARLGL
FT                   APSPSGGRLGWGHATLDETRLCSKGRRAPIPAFPRKGKEQCTKPGVPCLVFLPPLPGEG
FT                   RGGGTAAERSNGPTASRAKQWPGLSPPPSGCAEERSGSRTRARRCLSEASSARPREPRA
FT                   PQVARSEAEGRRQWGRLSFAYLSLAKQRKVGRLPGRDPASEKKQTQGQQEC"
     MGLESSFFPR PGLAPAGDLL SFASPKERKQ RKGDPAVCVP PLRCGQPAVL AFRGVRRTRF        60
     AQTAAALIRE TLRSSAHTEG LWGPHTPSLR SAAPSGLRFA RLGLAPSPSG GRLGWGHATL       120
     DETRLCSKGR RAPIPAFPRK GKEQCTKPGV PCLVFLPPLP GEGRGGGTAA ERSNGPTASR       180
     AKQWPGLSPP PSGCAEERSG SRTRARRCLS EASSARPREP RAPQVARSEA EGRRQWGRLS       240
     FAYLSLAKQR KVGRLPGRDP ASEKKQTQGQ QEC                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page