(data stored in SCRATCH zone)

EMBL: CP002417.PE443

CP002417.PE443       Location/Qualifiers
FT   CDS             complement(477216..478895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0444"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: vap:Vapar_0416 alpha amylase catalytic region;
FT                   PFAM: alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34666"
FT                   /db_xref="GOA:E6V4C0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C0"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADU34666.1"
FT                   /translation="MGSSINSSNSEWWRGAVIYQIYPRSFMDSNGDGIGDLPGITARLD
FT                   HVASLGVDAIWVSPFFRSPMKDFGYDVSDYRAVDPLFGTLADFDAMLARMHALGLKLII
FT                   DQVLSHTSDQHAWFAESRSSRDNPKADWYVWADPKPDGTPPTNWLSVFGGSAWQWDSRR
FT                   RQYYLHSFLTEQPDLNFHCTAVQDALLGEVRFWCERGVDGFRFDACNHQFHDALLRDNP
FT                   PASLASIDEVSTVRADNPYAMQQHLYDKSQQENLVFLERLRQLLDGYGAVALGEVGDEN
FT                   APPVMAQYTEFGKRLHLAYSFSLLTADHRAKHLRHQVETLDLALAPTGGWGCWAVSNHD
FT                   VPRVATRWSDGKAPDTRRDRLWLALLLILRGSASIYQGEELGLPEAEVPFELLQDPYGR
FT                   TFWPEFKGRDGCRTPMPWQADAPHGGFTTGTPWLPVYGPHLPLAIDNQADDPGSMLAFS
FT                   RALLHWRRAQPLLRTGGIVFFDAPEPLLWFERRDGNRSLQAIFNMGSEPVTIALREALV
FT                   PPQGHPLAATASVQGTSEKRMLALAPYGVFFGTPANEEEGQS"
     MGSSINSSNS EWWRGAVIYQ IYPRSFMDSN GDGIGDLPGI TARLDHVASL GVDAIWVSPF        60
     FRSPMKDFGY DVSDYRAVDP LFGTLADFDA MLARMHALGL KLIIDQVLSH TSDQHAWFAE       120
     SRSSRDNPKA DWYVWADPKP DGTPPTNWLS VFGGSAWQWD SRRRQYYLHS FLTEQPDLNF       180
     HCTAVQDALL GEVRFWCERG VDGFRFDACN HQFHDALLRD NPPASLASID EVSTVRADNP       240
     YAMQQHLYDK SQQENLVFLE RLRQLLDGYG AVALGEVGDE NAPPVMAQYT EFGKRLHLAY       300
     SFSLLTADHR AKHLRHQVET LDLALAPTGG WGCWAVSNHD VPRVATRWSD GKAPDTRRDR       360
     LWLALLLILR GSASIYQGEE LGLPEAEVPF ELLQDPYGRT FWPEFKGRDG CRTPMPWQAD       420
     APHGGFTTGT PWLPVYGPHL PLAIDNQADD PGSMLAFSRA LLHWRRAQPL LRTGGIVFFD       480
     APEPLLWFER RDGNRSLQAI FNMGSEPVTI ALREALVPPQ GHPLAATASV QGTSEKRMLA       540
     LAPYGVFFGT PANEEEGQS                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page