(data stored in ACNUC1104 zone)

EMBL: CP002417.PE444

CP002417.PE444       Location/Qualifiers
FT   CDS             479027..480481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0445"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   vap:Vapar_0417 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34667"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C1"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADU34667.1"
FT                   /translation="MTTSDPVSSLAALEARLAQDLDYLGFPGRQWMPVRQKDGEAMLDV
FT                   AVIGGGQAGLAASVALAQQSIRAVIFDRSPAGKEGPWATTARMETLRSPKELTGPALGL
FT                   PSLTFRAWFEAQFGREAWAAMDKIPRLQWMDYLAWYRRVMHVDVRNDTAVTGIHPLPDG
FT                   TAVRLDLRTRAGVGRVFARRVVLATGRDGLGGPAVPAFVNALPRSQWAHSSDAMDYGQL
FT                   AGLRVGVVGAGSSAMDSAATALEAGARSVELLIRRPDLPRVNKGKGAGVPGLTQGHFDL
FT                   SDERKWRIRHYINVANVPPPHGSTLRVSAFSNAFFNFGCPILSVAPQGDSMRVSTPRGD
FT                   FEFDFLIVSTGFKVDWPNRPEFDAIASHIRTWKDRFVPAPGDEDQELADSPDLGPVFEF
FT                   KERVPGECPGLERIHCFCYPAALSHGTVSGDIPAISDGAKRLASGIASLFYREDFDHHF
FT                   ANLEAYSEPELFGDEWTPAPPPGERG"
     MTTSDPVSSL AALEARLAQD LDYLGFPGRQ WMPVRQKDGE AMLDVAVIGG GQAGLAASVA        60
     LAQQSIRAVI FDRSPAGKEG PWATTARMET LRSPKELTGP ALGLPSLTFR AWFEAQFGRE       120
     AWAAMDKIPR LQWMDYLAWY RRVMHVDVRN DTAVTGIHPL PDGTAVRLDL RTRAGVGRVF       180
     ARRVVLATGR DGLGGPAVPA FVNALPRSQW AHSSDAMDYG QLAGLRVGVV GAGSSAMDSA       240
     ATALEAGARS VELLIRRPDL PRVNKGKGAG VPGLTQGHFD LSDERKWRIR HYINVANVPP       300
     PHGSTLRVSA FSNAFFNFGC PILSVAPQGD SMRVSTPRGD FEFDFLIVST GFKVDWPNRP       360
     EFDAIASHIR TWKDRFVPAP GDEDQELADS PDLGPVFEFK ERVPGECPGL ERIHCFCYPA       420
     ALSHGTVSGD IPAISDGAKR LASGIASLFY REDFDHHFAN LEAYSEPELF GDEWTPAPPP       480
     GERG                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page