(data stored in ACNUC1104 zone)

EMBL: CP002417.PE445

CP002417.PE445       Location/Qualifiers
FT   CDS             480608..483238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0446"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="KEGG: vap:Vapar_0422 leucyl-tRNA synthetase;
FT                   TIGRFAM: leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34668"
FT                   /db_xref="GOA:E6V4C2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C2"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ADU34668.1"
FT                   /translation="MNPSYKPSDVESAAQAQWSAADAYRVTEDASRKKYYACSMLPYPS
FT                   GKLHMGHVRNYTINDMLTRYLRMSGYNVLMPMGWDAFGLPAENAALKNGVPPAKWTYEN
FT                   IDYMRGQLQAMGLAIDWSREIATCDPSYYKWNQWLFLKMLEKGVAYRKTQVVNWDPVDQ
FT                   TVLANEQVIDGKGWRTGATVERREIPGYYLKISDYAEELLEHTQHKLPGWPERVKLMQE
FT                   NWIGKSEGVRFAFTHDIQDASGQLIQDGRMYVFTTRADTIMGVTFCAVAPEHPLAAHAA
FT                   TLDPKVAAFIEECKNGGTTEAELATQEKKGVPTGLTVKHPITEEQVPVWVGNYVLIGYG
FT                   DGAVMGVPAHDERDFAFANKYGIEIIQVVLVDDEPHFDYHKWQDWYGDKQRGVTINSDN
FT                   FSGMTYKEAVAAVAHALGQKGLGELQTTWRLRDWGVSRQRYWGTPIPIIHCEEHGAVPV
FT                   PEKDLPVVLPTDCVPDGSGNPLNKHEGFHAGVVCPVCGKAARRETDTMDTFVDSSWYFM
FT                   RYCDPKNDQAMVAEGADYWMPMDQYIGGIEHAILHLLYARFWTKVMRDLGLVKADEPFA
FT                   KLLTQGMVLNHIFYKRNEKGGKDYFPPLEVTPVLDAQGRITGGTTADGTKVEYGGVGKM
FT                   GKSERNGVDPQDLIEKYGADTARLYTMFTAPPEATLEWNDAAVEGSYRFLRRVWNFGVT
FT                   QADVAPAKAGTQAFGKAAQALRREVHTVLRQVDYDYQRMQYNTVVSGAMKLLNALEGFK
FT                   PDGSAGDAAAVREGFGILLRCLYPATPHIAQQLWTELGYDKDLGGLLDAAWPTVDVEAL
FT                   VQDEIELMLQVNGKLRGKLLVPAGASKDEIEKLALACDDFVAFAEGAPPKRVIVVPGRL
FT                   VNVVL"
     MNPSYKPSDV ESAAQAQWSA ADAYRVTEDA SRKKYYACSM LPYPSGKLHM GHVRNYTIND        60
     MLTRYLRMSG YNVLMPMGWD AFGLPAENAA LKNGVPPAKW TYENIDYMRG QLQAMGLAID       120
     WSREIATCDP SYYKWNQWLF LKMLEKGVAY RKTQVVNWDP VDQTVLANEQ VIDGKGWRTG       180
     ATVERREIPG YYLKISDYAE ELLEHTQHKL PGWPERVKLM QENWIGKSEG VRFAFTHDIQ       240
     DASGQLIQDG RMYVFTTRAD TIMGVTFCAV APEHPLAAHA ATLDPKVAAF IEECKNGGTT       300
     EAELATQEKK GVPTGLTVKH PITEEQVPVW VGNYVLIGYG DGAVMGVPAH DERDFAFANK       360
     YGIEIIQVVL VDDEPHFDYH KWQDWYGDKQ RGVTINSDNF SGMTYKEAVA AVAHALGQKG       420
     LGELQTTWRL RDWGVSRQRY WGTPIPIIHC EEHGAVPVPE KDLPVVLPTD CVPDGSGNPL       480
     NKHEGFHAGV VCPVCGKAAR RETDTMDTFV DSSWYFMRYC DPKNDQAMVA EGADYWMPMD       540
     QYIGGIEHAI LHLLYARFWT KVMRDLGLVK ADEPFAKLLT QGMVLNHIFY KRNEKGGKDY       600
     FPPLEVTPVL DAQGRITGGT TADGTKVEYG GVGKMGKSER NGVDPQDLIE KYGADTARLY       660
     TMFTAPPEAT LEWNDAAVEG SYRFLRRVWN FGVTQADVAP AKAGTQAFGK AAQALRREVH       720
     TVLRQVDYDY QRMQYNTVVS GAMKLLNALE GFKPDGSAGD AAAVREGFGI LLRCLYPATP       780
     HIAQQLWTEL GYDKDLGGLL DAAWPTVDVE ALVQDEIELM LQVNGKLRGK LLVPAGASKD       840
     EIEKLALACD DFVAFAEGAP PKRVIVVPGR LVNVVL                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page