(data stored in ACNUC1104 zone)

EMBL: CP002417.PE448

CP002417.PE448       Location/Qualifiers
FT   CDS             484948..486243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0449"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   vap:Vapar_0425 gamma-glutamyl phosphate reductase; PFAM:
FT                   Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34671"
FT                   /db_xref="GOA:E6V4C5"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C5"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ADU34671.1"
FT                   /translation="MNAFNVSEHMQALGLQAKTAAFLMARADAATKNIALKALARRLRE
FT                   AGPALSVANQKDLERATAAGLSAPMVDRLKLTPKVIETVALGCEQLAGMADVIGEMIGM
FT                   KQQPSGIRVGQMRVPIGVFGMIYESRPNVTIEAASLAIKSGNAAILRGGSEAIESNKAL
FT                   ALLVSEALAEAGLPVEAVQLVQTTDREAVGQLIAMPEFVDVIIPRGGKGLIERISRDAK
FT                   VPVIKHLDGNCHVYVDDTAEFGMALRIVDNAKTQKYSPCNAAEGLLVSEVVAEDFLPQI
FT                   AAIFAAKGVEMRCDPAAARILRSDEAALDPAAKVIDAVETDWSEEYLAAVISIKVVAGV
FT                   DEAIAHINRYSSHHTDAIVTRDHVHAQRFLREVDSASVMVNASTRFADGFEFGLGAEIG
FT                   ISTDKFHARGPVGIEGLTSLKYVVLGQGEVRT"
     MNAFNVSEHM QALGLQAKTA AFLMARADAA TKNIALKALA RRLREAGPAL SVANQKDLER        60
     ATAAGLSAPM VDRLKLTPKV IETVALGCEQ LAGMADVIGE MIGMKQQPSG IRVGQMRVPI       120
     GVFGMIYESR PNVTIEAASL AIKSGNAAIL RGGSEAIESN KALALLVSEA LAEAGLPVEA       180
     VQLVQTTDRE AVGQLIAMPE FVDVIIPRGG KGLIERISRD AKVPVIKHLD GNCHVYVDDT       240
     AEFGMALRIV DNAKTQKYSP CNAAEGLLVS EVVAEDFLPQ IAAIFAAKGV EMRCDPAAAR       300
     ILRSDEAALD PAAKVIDAVE TDWSEEYLAA VISIKVVAGV DEAIAHINRY SSHHTDAIVT       360
     RDHVHAQRFL REVDSASVMV NASTRFADGF EFGLGAEIGI STDKFHARGP VGIEGLTSLK       420
     YVVLGQGEVR T                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page