(data stored in SCRATCH zone)

EMBL: CP002417.PE45

CP002417.PE45        Location/Qualifiers
FT   CDS             complement(47447..49276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0045"
FT                   /product="protein of unknown function DUF1446"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   vap:Vapar_0040 protein of unknown function DUF1446"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34268"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS4"
FT                   /inference="protein motif:PFAM:PF07287"
FT                   /protein_id="ADU34268.1"
FT                   /translation="MKDSSNTNERIVRIGGASGFWGDSSVGAPQLVASGKIDYLVFDYL
FT                   AELTMSILAGARLKKPELGYATDFVSVAMKSVLRDVVKQGIRVVSNAGGVNPQGCADAL
FT                   AALAKEQGIELKIAVVSGDDVSALLPQLRQAQPPVRELQSGAALPERVLTANAYLGARP
FT                   IQAALDAGAQVVITGRCVDSAVTLGVLMHEFKWQPGDHDLLAAGSLAGHIIECGCQATG
FT                   GLHTDWDTVPDWPHIGYPIVECSADGSFVVTKPAGTGGKLVPAVVGEQMLYEIGDPAAY
FT                   LLPDVTADFTQVRIEQAGEHRVRVHGARGRAPTTTYKVSATYVDGFKTAAQLTIVGFDA
FT                   AAKARRTGEAILARTSELFAQFGFGPYSATHIEMLGAESCYGPHANAQVLQTREVVLRL
FT                   AVTHPRKEALELFAREVAPAGTSWSPGTTGAGGGRASVSPSIQQYAFLLDKSQVQASVN
FT                   VDGQRIDVPRTLAPAAADMPAPRPAGATPHEAAPEAADTVEVPLIRLAWARSGDKGDTS
FT                   NIGVIARHPALLPLLRDQLTEARVAEWLAHLVKGRVTRYEVPGIDAFNFVCEEALGGGG
FT                   MASLRNDPLGKGMGQILLAVPLRVSAALLALVS"
     MKDSSNTNER IVRIGGASGF WGDSSVGAPQ LVASGKIDYL VFDYLAELTM SILAGARLKK        60
     PELGYATDFV SVAMKSVLRD VVKQGIRVVS NAGGVNPQGC ADALAALAKE QGIELKIAVV       120
     SGDDVSALLP QLRQAQPPVR ELQSGAALPE RVLTANAYLG ARPIQAALDA GAQVVITGRC       180
     VDSAVTLGVL MHEFKWQPGD HDLLAAGSLA GHIIECGCQA TGGLHTDWDT VPDWPHIGYP       240
     IVECSADGSF VVTKPAGTGG KLVPAVVGEQ MLYEIGDPAA YLLPDVTADF TQVRIEQAGE       300
     HRVRVHGARG RAPTTTYKVS ATYVDGFKTA AQLTIVGFDA AAKARRTGEA ILARTSELFA       360
     QFGFGPYSAT HIEMLGAESC YGPHANAQVL QTREVVLRLA VTHPRKEALE LFAREVAPAG       420
     TSWSPGTTGA GGGRASVSPS IQQYAFLLDK SQVQASVNVD GQRIDVPRTL APAAADMPAP       480
     RPAGATPHEA APEAADTVEV PLIRLAWARS GDKGDTSNIG VIARHPALLP LLRDQLTEAR       540
     VAEWLAHLVK GRVTRYEVPG IDAFNFVCEE ALGGGGMASL RNDPLGKGMG QILLAVPLRV       600
     SAALLALVS                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page