(data stored in ACNUC1104 zone)

EMBL: CP002417.PE450

CP002417.PE450       Location/Qualifiers
FT   CDS             487836..489704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0451"
FT                   /product="potassium transporter"
FT                   /note="PFAM: K potassium transporter; KEGG: vap:Vapar_0427
FT                   K potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34673"
FT                   /db_xref="GOA:E6V4C7"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C7"
FT                   /inference="protein motif:PFAM:PF02705"
FT                   /protein_id="ADU34673.1"
FT                   /translation="MSAPKTISAGLIVGAIGVVYGDIGTSVLYAVKEVFGHGHVPFTVQ
FT                   NVYGILSMFFWTLTVIVSIKYVVLVLRADNEGEGGLVAMLALASRAVADKPRLRHVLLV
FT                   IGIFGTSLFYGDGVITPAISVLSAVEGLEVVSPHFKHYVIPITLVVLFCLFAVQKRGTA
FT                   GIGKFFGPVTLAWFAAIAVLGVWQILHHPEIVKALNPWYALKFIWDNPGTSFILLGAMV
FT                   LCVTGAEALYADLGHFGKKPIRIAWFSVVMPALTLNYLGQGALLLENPEAVKNPFFMMA
FT                   PEWALIPLVLLATLSTVIASQALITGAFSVTRQVIQLGYLPRLNIEHTSVRTAGQIYIP
FT                   LVNWGLFVAIVLAVVMFRTSSSLAAAYGIAVTTDMLITTILTFFVIRYAWKLPLALCIA
FT                   STAVFFVVDFLFFASNLLKMFEGGWFPLLIGGFVFTLMITWKEGRRLMGEAQHADAIDL
FT                   KSFLDSVFVSPPARVDGTAVFLTAEPGVVPNALLHNLKHNKVLHEQNMFVTVRNHEVPW
FT                   IPMDKRIEIEALGHHCWQVIVHYGFKNDIDLPRALEHARLRGCQLEPMATSYFLSRDVV
FT                   IPTLGSGMAPWREKLFAQMHHNASGAAAFLGLPNNAVVELGSKIEI"
     MSAPKTISAG LIVGAIGVVY GDIGTSVLYA VKEVFGHGHV PFTVQNVYGI LSMFFWTLTV        60
     IVSIKYVVLV LRADNEGEGG LVAMLALASR AVADKPRLRH VLLVIGIFGT SLFYGDGVIT       120
     PAISVLSAVE GLEVVSPHFK HYVIPITLVV LFCLFAVQKR GTAGIGKFFG PVTLAWFAAI       180
     AVLGVWQILH HPEIVKALNP WYALKFIWDN PGTSFILLGA MVLCVTGAEA LYADLGHFGK       240
     KPIRIAWFSV VMPALTLNYL GQGALLLENP EAVKNPFFMM APEWALIPLV LLATLSTVIA       300
     SQALITGAFS VTRQVIQLGY LPRLNIEHTS VRTAGQIYIP LVNWGLFVAI VLAVVMFRTS       360
     SSLAAAYGIA VTTDMLITTI LTFFVIRYAW KLPLALCIAS TAVFFVVDFL FFASNLLKMF       420
     EGGWFPLLIG GFVFTLMITW KEGRRLMGEA QHADAIDLKS FLDSVFVSPP ARVDGTAVFL       480
     TAEPGVVPNA LLHNLKHNKV LHEQNMFVTV RNHEVPWIPM DKRIEIEALG HHCWQVIVHY       540
     GFKNDIDLPR ALEHARLRGC QLEPMATSYF LSRDVVIPTL GSGMAPWREK LFAQMHHNAS       600
     GAAAFLGLPN NAVVELGSKI EI                                                622
//

If you have problems or comments...

PBIL Back to PBIL home page