(data stored in ACNUC1104 zone)

EMBL: CP002417.PE451

CP002417.PE451       Location/Qualifiers
FT   CDS             complement(489730..490653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0452"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   vap:Vapar_0429 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34674"
FT                   /db_xref="GOA:E6V4C8"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C8"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADU34674.1"
FT                   /translation="MTTRWPDLLPSHDRFDYRPITRRPDYVWPNGARLAVYLGFNIEHF
FT                   AFGDGLGACIGPASPQPDVLNHGWREYGNRVGAWRCLELFDALALPTGALINTALYDHC
FT                   PELVAACVARGDELIGHGHSNAERQGALDEEHERALLLRCRERMLRESGQAPAGWLSPW
FT                   ISESAVTPDLLGETGYGYTLNWCHDDQPVRMRTRGGGSIWSVPYPQELNDIPMIVGRLM
FT                   DAKDFSAMVVDNFDEMLEQSRAQPLVMGLALHPYIVGQPYRLRHLRTALAHLARARDRG
FT                   EIWFTTPGAIAGHMTQLAAERPEEFG"
     MTTRWPDLLP SHDRFDYRPI TRRPDYVWPN GARLAVYLGF NIEHFAFGDG LGACIGPASP        60
     QPDVLNHGWR EYGNRVGAWR CLELFDALAL PTGALINTAL YDHCPELVAA CVARGDELIG       120
     HGHSNAERQG ALDEEHERAL LLRCRERMLR ESGQAPAGWL SPWISESAVT PDLLGETGYG       180
     YTLNWCHDDQ PVRMRTRGGG SIWSVPYPQE LNDIPMIVGR LMDAKDFSAM VVDNFDEMLE       240
     QSRAQPLVMG LALHPYIVGQ PYRLRHLRTA LAHLARARDR GEIWFTTPGA IAGHMTQLAA       300
     ERPEEFG                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page