(data stored in SCRATCH zone)

EMBL: CP002417.PE453

CP002417.PE453       Location/Qualifiers
FT   CDS             491372..492325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0454"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: glutathione synthetase; KEGG:
FT                   vap:Vapar_0432 glutathione synthetase; PFAM: glutathione
FT                   synthetase ATP-binding; glutathione synthetase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34676"
FT                   /db_xref="GOA:E6V4D0"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D0"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ADU34676.1"
FT                   /translation="MKNILFVADPLDHFKIYKDTTFSMMREAQRRGHRIAACLPQDIQW
FT                   KSGGLVTATVQQITLTGDAKDWYTVDITESKALKDFDAVLMRKDPPFDAEYIYSTHLLQ
FT                   QAEREGAQVVNSPRALRDHPEKLAIMEFPQFVTPTLVTRSAQAVRDFHAEHGDIILKPL
FT                   DGMGGMGIFRVKQDALNLGSIVETLNKDGAETIMVQRFVPEVSQGDKRILIIAGEPAPF
FT                   VLARIPQGTEVRGNLAAGGKGVAQPLTPRNREIAEAIGKVLAPRGLLLIGLDVIGDSVT
FT                   EINVTSPTCFQEITEQTGFDVPKMFIDALEKTLRPA"
     MKNILFVADP LDHFKIYKDT TFSMMREAQR RGHRIAACLP QDIQWKSGGL VTATVQQITL        60
     TGDAKDWYTV DITESKALKD FDAVLMRKDP PFDAEYIYST HLLQQAEREG AQVVNSPRAL       120
     RDHPEKLAIM EFPQFVTPTL VTRSAQAVRD FHAEHGDIIL KPLDGMGGMG IFRVKQDALN       180
     LGSIVETLNK DGAETIMVQR FVPEVSQGDK RILIIAGEPA PFVLARIPQG TEVRGNLAAG       240
     GKGVAQPLTP RNREIAEAIG KVLAPRGLLL IGLDVIGDSV TEINVTSPTC FQEITEQTGF       300
     DVPKMFIDAL EKTLRPA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page