(data stored in ACNUC1104 zone)

EMBL: CP002417.PE455

CP002417.PE455       Location/Qualifiers
FT   CDS             complement(493592..495784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0456"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="manually curated; TIGRFAM: TonB-dependent
FT                   siderophore receptor; KEGG: ctt:CtCNB1_3496 TonB-dependent
FT                   siderophore receptor; PFAM: TonB-dependent receptor;
FT                   TonB-dependent receptor plug"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34678"
FT                   /db_xref="GOA:E6V4D2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D2"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ADU34678.1"
FT                   /translation="MAASLLALHALGAMAQTPAAEPAASSGTLATVNVEASADASAEGL
FT                   TKPYAGGQVARGGRVGILGNQDMMSTPFSSTNYTNELIQDQQAKSVADVLLNDPSVRQA
FT                   RGFGNFQELYVVRGFPVYSDDVAYNGLYGMLPRQYIASEFFERVEVFRGANSFLNGAAP
FT                   GGSGIGGAINLLPKRAPNEPLTRVGFGVQSGGQGFVNLDLARRFGRDDSLGVRVNAVRR
FT                   EGGTGVFKESQQLSAFGVGLDWHSRNVRLSADFGYQDYDLKDGRPSLTPSSTLPIPRVP
FT                   DAKSNFAQPWTYSKEKDKFATFRGEVDITDNITAWAAGGVRRSDEDNVLSNPALVNSFG
FT                   NTSNTRFSNTRKDRIGTAEIGVRGNFTTGPVKHTVVASATTYSNDRDNAYAISSGSVRN
FT                   NIYAPFFSPYPVANGTGGFVGNRLEDPRLTDKIDTSSVAVADTMSFMEDRLLVTLGARR
FT                   QTIKQTSFAYNTIKETSAYDKSKTTPVAGVVFKITPTVSAYANYIEALVQGKVAPATAN
FT                   NRPVANGGEVFAPYQAKQKEIGVKYDGGSLGASAAFFTIDQPVYQYADEAAGQVYGLYG
FT                   KQRNQGLEFSVFGEPTKGLRLLGGLTLLDAKQKNTQGGATDGLTAIGVAKQQANLSAEW
FT                   DVPGVRNLSLNARLLYTSKQYANAANTQQIPGWTRFDIGARYLVDLGNGRALTLRARID
FT                   NLFNKSYWASVGGTQGSNYLTLGAPRTFAVSGTIDF"
     MAASLLALHA LGAMAQTPAA EPAASSGTLA TVNVEASADA SAEGLTKPYA GGQVARGGRV        60
     GILGNQDMMS TPFSSTNYTN ELIQDQQAKS VADVLLNDPS VRQARGFGNF QELYVVRGFP       120
     VYSDDVAYNG LYGMLPRQYI ASEFFERVEV FRGANSFLNG AAPGGSGIGG AINLLPKRAP       180
     NEPLTRVGFG VQSGGQGFVN LDLARRFGRD DSLGVRVNAV RREGGTGVFK ESQQLSAFGV       240
     GLDWHSRNVR LSADFGYQDY DLKDGRPSLT PSSTLPIPRV PDAKSNFAQP WTYSKEKDKF       300
     ATFRGEVDIT DNITAWAAGG VRRSDEDNVL SNPALVNSFG NTSNTRFSNT RKDRIGTAEI       360
     GVRGNFTTGP VKHTVVASAT TYSNDRDNAY AISSGSVRNN IYAPFFSPYP VANGTGGFVG       420
     NRLEDPRLTD KIDTSSVAVA DTMSFMEDRL LVTLGARRQT IKQTSFAYNT IKETSAYDKS       480
     KTTPVAGVVF KITPTVSAYA NYIEALVQGK VAPATANNRP VANGGEVFAP YQAKQKEIGV       540
     KYDGGSLGAS AAFFTIDQPV YQYADEAAGQ VYGLYGKQRN QGLEFSVFGE PTKGLRLLGG       600
     LTLLDAKQKN TQGGATDGLT AIGVAKQQAN LSAEWDVPGV RNLSLNARLL YTSKQYANAA       660
     NTQQIPGWTR FDIGARYLVD LGNGRALTLR ARIDNLFNKS YWASVGGTQG SNYLTLGAPR       720
     TFAVSGTIDF                                                              730
//

If you have problems or comments...

PBIL Back to PBIL home page