(data stored in ACNUC1104 zone)

EMBL: CP002417.PE456

CP002417.PE456       Location/Qualifiers
FT   CDS             complement(495915..496703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0457"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="KEGG: vap:Vapar_0435 glutamine amidotransferase
FT                   class-II; manually curated; PFAM: glutamine
FT                   amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34679"
FT                   /db_xref="GOA:E6V4D3"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D3"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADU34679.1"
FT                   /translation="MCQLLGMNCNTPTDVTFSFTGFAQRGGRTDHHADGWGIAFFEDRG
FT                   LRHFVDHQPACESPVAELIRRYPIQSRNVIAHIRKATQGEVNLQNCHPFVRELWGRYWV
FT                   FAHNGDLKDFRPRLHGNFHPVGNTDSEHAFCWLMQELAKSHAGVPSIDELTLTLRELAP
FT                   QLASHGTFNFMLSNGQALWAHASTNLWYVERRHPFVTAQLSDEDLEIDFAQHTTPTDRV
FT                   AVVVTTPLTTNETWTQFAPGELHVFVDGQRSVGRDPNEAF"
     MCQLLGMNCN TPTDVTFSFT GFAQRGGRTD HHADGWGIAF FEDRGLRHFV DHQPACESPV        60
     AELIRRYPIQ SRNVIAHIRK ATQGEVNLQN CHPFVRELWG RYWVFAHNGD LKDFRPRLHG       120
     NFHPVGNTDS EHAFCWLMQE LAKSHAGVPS IDELTLTLRE LAPQLASHGT FNFMLSNGQA       180
     LWAHASTNLW YVERRHPFVT AQLSDEDLEI DFAQHTTPTD RVAVVVTTPL TTNETWTQFA       240
     PGELHVFVDG QRSVGRDPNE AF                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page