(data stored in ACNUC1104 zone)

EMBL: CP002417.PE46

CP002417.PE46        Location/Qualifiers
FT   CDS             complement(49273..50055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0046"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   vap:Vapar_0041 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34269"
FT                   /db_xref="GOA:E6UXS5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS5"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU34269.1"
FT                   /translation="MAETSSTIELREEMRGPVMWLTIDREERRNAINAAVLARLSDALA
FT                   RANADAAVRAVVITGTGTRAFCAGADLQSGTSFKFDYAEPYQGFANLFRQARQSTVPLI
FT                   ARVNGACMAGGMGIMAMCDMAVASSSAVFGLPEVKVGLFPAQVLSVLDGLLPRRVLAEM
FT                   CITGEPITAAQALEHGLINRTSDDVDESIDWLLGRMLDKSPAAIRRGLYTMKKIEAMAF
FT                   EESMAFTESQIGLFALTEDAAEGQLAFREKRKPQWSGR"
     MAETSSTIEL REEMRGPVMW LTIDREERRN AINAAVLARL SDALARANAD AAVRAVVITG        60
     TGTRAFCAGA DLQSGTSFKF DYAEPYQGFA NLFRQARQST VPLIARVNGA CMAGGMGIMA       120
     MCDMAVASSS AVFGLPEVKV GLFPAQVLSV LDGLLPRRVL AEMCITGEPI TAAQALEHGL       180
     INRTSDDVDE SIDWLLGRML DKSPAAIRRG LYTMKKIEAM AFEESMAFTE SQIGLFALTE       240
     DAAEGQLAFR EKRKPQWSGR                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page