(data stored in SCRATCH zone)

EMBL: CP002417.PE464

CP002417.PE464       Location/Qualifiers
FT   CDS             503694..504629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0465"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0447 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34687"
FT                   /db_xref="GOA:E6V4E1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34687.1"
FT                   /translation="MPPANAKPSKLPSSELPPLDLLRSFEAAARQLSFTLAAGELHLTQ
FT                   SAVSRQIQQLEASLGVLLFERRHRALALTEAGGVLQRAVTDSLERLRDATARVRASAAP
FT                   RQVAITCTPGFASLWLIPKLARFTGTHPQVDVRLSATLDVLDLDVSRLDLAVRFAPIAR
FT                   GVGPALFEESVIPLCAPQVAASLRALSDFSGLTLLTIEYPDHSEAPTADWEPWLKVMGL
FT                   EDLRVKSTLRFTQYADAVAAAVAGQGVVIGRLPLLRELVRDGRLVAPLGEGAASHRGYF
FT                   IEMSRRAASNRDAQDFAQWLRDEAEAAQRT"
     MPPANAKPSK LPSSELPPLD LLRSFEAAAR QLSFTLAAGE LHLTQSAVSR QIQQLEASLG        60
     VLLFERRHRA LALTEAGGVL QRAVTDSLER LRDATARVRA SAAPRQVAIT CTPGFASLWL       120
     IPKLARFTGT HPQVDVRLSA TLDVLDLDVS RLDLAVRFAP IARGVGPALF EESVIPLCAP       180
     QVAASLRALS DFSGLTLLTI EYPDHSEAPT ADWEPWLKVM GLEDLRVKST LRFTQYADAV       240
     AAAVAGQGVV IGRLPLLREL VRDGRLVAPL GEGAASHRGY FIEMSRRAAS NRDAQDFAQW       300
     LRDEAEAAQR T                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page