(data stored in ACNUC1104 zone)

EMBL: CP002417.PE468

CP002417.PE468       Location/Qualifiers
FT   CDS             506669..507949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0469"
FT                   /product="protein of unknown function DUF1016"
FT                   /note="PFAM: protein of unknown function DUF1016; KEGG:
FT                   vap:Vapar_0451 protein of unknown function DUF1016"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34691"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E5"
FT                   /inference="protein motif:PFAM:PF06250"
FT                   /protein_id="ADU34691.1"
FT                   /translation="MWANVARALPRIIQDELPQSVALPTSDKTPPRAAKTTRAKAASSS
FT                   NALLARVREILEAARAGVARTVNTTQVAANWLIGREIVEEEQRGQRRAGYGAKLLAELS
FT                   ARLNAEFGRGYSVDNLEAFRQFYLDYPQLISETASRKSTVIRELPAQPISATPSRKSIS
FT                   ESDWLPGVLHPSLSWSHYRQLLRVARMEARAFYEIEAIRNAWSVRELQRQAASLLYDRL
FT                   AKSKDKKGLMRLATHGQEVAQPLDALKDPMVIEFLGLPESPRLVESALEQALIDNLQTF
FT                   LLELGKGFAFVSRQERITIDGDHFYIDLVFYHAVLKCYVLIDLKVGKLTHADLGQIQFY
FT                   VNYYDRERRTEGDNPTLGVILCPDKNDAVVKYTLGEQQERNIFASRYQLHLPTEQELES
FT                   ELRREIRYLSVSEAVRVPAKKQAKRGA"
     MWANVARALP RIIQDELPQS VALPTSDKTP PRAAKTTRAK AASSSNALLA RVREILEAAR        60
     AGVARTVNTT QVAANWLIGR EIVEEEQRGQ RRAGYGAKLL AELSARLNAE FGRGYSVDNL       120
     EAFRQFYLDY PQLISETASR KSTVIRELPA QPISATPSRK SISESDWLPG VLHPSLSWSH       180
     YRQLLRVARM EARAFYEIEA IRNAWSVREL QRQAASLLYD RLAKSKDKKG LMRLATHGQE       240
     VAQPLDALKD PMVIEFLGLP ESPRLVESAL EQALIDNLQT FLLELGKGFA FVSRQERITI       300
     DGDHFYIDLV FYHAVLKCYV LIDLKVGKLT HADLGQIQFY VNYYDRERRT EGDNPTLGVI       360
     LCPDKNDAVV KYTLGEQQER NIFASRYQLH LPTEQELESE LRREIRYLSV SEAVRVPAKK       420
     QAKRGA                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page