(data stored in ACNUC1104 zone)

EMBL: CP002417.PE47

CP002417.PE47        Location/Qualifiers
FT   CDS             complement(50203..50811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0047"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   vap:Vapar_0042 glutathione S-transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34270"
FT                   /db_xref="GOA:E6UXS6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS6"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ADU34270.1"
FT                   /translation="MKLYYSPGACSLSPHIALHEAGLAFEPVMASTKSHKLQDGTDYYG
FT                   INPLGYVPMLELDDGTRLREGPAIVQYIADLAPTKNLAPANGTLQRYRLQEWLTFIGTE
FT                   MHKGYSPLFNPNMPEEAKTIFKDKLKSRYEWLDGQLADKQYLMGEHFSVADGYLFTVTN
FT                   WTKPTGVDISAFANVQAWHARVAARPAVQEAMKAEGLLK"
     MKLYYSPGAC SLSPHIALHE AGLAFEPVMA STKSHKLQDG TDYYGINPLG YVPMLELDDG        60
     TRLREGPAIV QYIADLAPTK NLAPANGTLQ RYRLQEWLTF IGTEMHKGYS PLFNPNMPEE       120
     AKTIFKDKLK SRYEWLDGQL ADKQYLMGEH FSVADGYLFT VTNWTKPTGV DISAFANVQA       180
     WHARVAARPA VQEAMKAEGL LK                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page