(data stored in ACNUC1104 zone)

EMBL: CP002417.PE471

CP002417.PE471       Location/Qualifiers
FT   CDS             511816..512793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0472"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="KEGG: cti:RALTA_A0774 histidinol-phosphate
FT                   aminotransferase; TIGRFAM: histidinol-phosphate
FT                   aminotransferase; PFAM: aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34694"
FT                   /db_xref="GOA:E6V4E8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E8"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ADU34694.1"
FT                   /translation="MILLASNENPLGMPESARRAAAAALEGAGNYPDSNGTALKNALAA
FT                   RLDVSPEWLTLGSGSSEILELAAQVSLKPGENVVYSQYGFIVYAQATAHAHARASVVPS
FT                   QDFGHDLGAMRAAIADDTKLVFVANPNNPTGTFIDAGPLRDFLQSVPAHVTVLLDEAYT
FT                   EYLSPAQRYDSIEWVRRLPNLIVARTFSKAFGLAGMRIGYGVSQPPLTSRMNAQRPRFN
FT                   VTTPAQAAAVAALGDTEFLARTYELNTAGREQLAAGFTELGLVHIPSSGNFLMVQVGDA
FT                   QAVHARLLAAGIEVSLLGPYGLPQWLRVSVGLPEQNEALLAALR"
     MILLASNENP LGMPESARRA AAAALEGAGN YPDSNGTALK NALAARLDVS PEWLTLGSGS        60
     SEILELAAQV SLKPGENVVY SQYGFIVYAQ ATAHAHARAS VVPSQDFGHD LGAMRAAIAD       120
     DTKLVFVANP NNPTGTFIDA GPLRDFLQSV PAHVTVLLDE AYTEYLSPAQ RYDSIEWVRR       180
     LPNLIVARTF SKAFGLAGMR IGYGVSQPPL TSRMNAQRPR FNVTTPAQAA AVAALGDTEF       240
     LARTYELNTA GREQLAAGFT ELGLVHIPSS GNFLMVQVGD AQAVHARLLA AGIEVSLLGP       300
     YGLPQWLRVS VGLPEQNEAL LAALR                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page