(data stored in ACNUC1104 zone)

EMBL: CP002417.PE472

CP002417.PE472       Location/Qualifiers
FT   CDS             complement(512922..513662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0473"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: vap:Vapar_0454 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34695"
FT                   /db_xref="GOA:E6V4E9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E9"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADU34695.1"
FT                   /translation="MPRKAQTESVSDLNAAPGGAAAVDRALSLLSAFRPGDEALSLAQF
FT                   AERTQLYKSTALRLLASLEHARLIRRQDDGRYALGMEIARLHGLYAASQSLDRIVLPVL
FT                   RALAAATGESAAYHVRQDQGDGWVRLCQFRVDSSHVVRDHVRAGDLLPNDRGAGARVLI
FT                   AFGPDTERPRGARERKLYEAIRAQGCCALVGDRTAELAGISAPVFHADGSLAAAVTLTM
FT                   PTHRYDEGYIEPVRAAAKELSGQV"
     MPRKAQTESV SDLNAAPGGA AAVDRALSLL SAFRPGDEAL SLAQFAERTQ LYKSTALRLL        60
     ASLEHARLIR RQDDGRYALG MEIARLHGLY AASQSLDRIV LPVLRALAAA TGESAAYHVR       120
     QDQGDGWVRL CQFRVDSSHV VRDHVRAGDL LPNDRGAGAR VLIAFGPDTE RPRGARERKL       180
     YEAIRAQGCC ALVGDRTAEL AGISAPVFHA DGSLAAAVTL TMPTHRYDEG YIEPVRAAAK       240
     ELSGQV                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page