(data stored in ACNUC1104 zone)

EMBL: CP002417.PE476

CP002417.PE476       Location/Qualifiers
FT   CDS             516936..517388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0477"
FT                   /product="Protein of unknown function DUF2214, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2214, membrane;
FT                   KEGG: vap:Vapar_0458 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34699"
FT                   /db_xref="GOA:E6V4F3"
FT                   /db_xref="InterPro:IPR018706"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F3"
FT                   /inference="protein motif:PFAM:PF09980"
FT                   /protein_id="ADU34699.1"
FT                   /translation="MTLEAILAYVHLLAILTMVVFISSEAALCRVQWLNAAVVERLAKV
FT                   DMVYGIAAIAVLATGIARTWWGVKGTAWYWTNPLLHVKLGLFIIVGVLSIFPTLTYFRW
FT                   RKTLRSTGKLPVEADIKKTRKLVMVQAHLIALIPLVAVFLARGFGK"
     MTLEAILAYV HLLAILTMVV FISSEAALCR VQWLNAAVVE RLAKVDMVYG IAAIAVLATG        60
     IARTWWGVKG TAWYWTNPLL HVKLGLFIIV GVLSIFPTLT YFRWRKTLRS TGKLPVEADI       120
     KKTRKLVMVQ AHLIALIPLV AVFLARGFGK                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page