(data stored in SCRATCH zone)

EMBL: CP002417.PE477

CP002417.PE477       Location/Qualifiers
FT   CDS             complement(517473..517817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0478"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34700"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0460"
FT                   /protein_id="ADU34700.1"
FT                   /translation="MKKFLSLVALGACLSFGAAQAQDKAPAPAVAPAAAAPAAAAPAAG
FT                   ATCDAKAIDKNGKPLAGAAKASSIKKCEKETKAAAAPACAAKAIDKNGKPLAGAAKNSF
FT                   IKKCEKDAKA"
     MKKFLSLVAL GACLSFGAAQ AQDKAPAPAV APAAAAPAAA APAAGATCDA KAIDKNGKPL        60
     AGAAKASSIK KCEKETKAAA APACAAKAID KNGKPLAGAA KNSFIKKCEK DAKA             114
//

If you have problems or comments...

PBIL Back to PBIL home page