(data stored in SCRATCH zone)

EMBL: CP002417.PE481

CP002417.PE481       Location/Qualifiers
FT   CDS             521416..522132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0482"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="KEGG: vap:Vapar_0464 lipopolysaccharide transport
FT                   periplasmic protein LptA; TIGRFAM: lipopolysaccharide
FT                   transport periplasmic protein LptA; PFAM: OstA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34704"
FT                   /db_xref="GOA:E6V4F8"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F8"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ADU34704.1"
FT                   /translation="MTLPSYPNNTPLVRRIGRLAIGALLLAGLASGVLAETADRSKPMN
FT                   IESDAMRYDDLKQTSVFTGNVLVTKGTIIIRGARLDVRQDAEGYQYGVVTAAPGKRAYY
FT                   KQKRNAPDEWIEGESEVIEYDSRADNVKFIRNATMRRLLGATPNDESQGALIVYDQSND
FT                   TYTVNGSTVPPNTAVNASTPTGRVKTILTPKAATAPKPGASAPAGAKPAAPASTPAPGT
FT                   GLRSTTTLSGEGEGRK"
     MTLPSYPNNT PLVRRIGRLA IGALLLAGLA SGVLAETADR SKPMNIESDA MRYDDLKQTS        60
     VFTGNVLVTK GTIIIRGARL DVRQDAEGYQ YGVVTAAPGK RAYYKQKRNA PDEWIEGESE       120
     VIEYDSRADN VKFIRNATMR RLLGATPNDE SQGALIVYDQ SNDTYTVNGS TVPPNTAVNA       180
     STPTGRVKTI LTPKAATAPK PGASAPAGAK PAAPASTPAP GTGLRSTTTL SGEGEGRK         238
//

If you have problems or comments...

PBIL Back to PBIL home page