(data stored in ACNUC1104 zone)

EMBL: CP002417.PE484

CP002417.PE484       Location/Qualifiers
FT   CDS             524542..526143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0485"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: vap:Vapar_0467 phospholipase
FT                   D/transphosphatidylase; PFAM: phospholipase
FT                   D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34707"
FT                   /db_xref="GOA:E6V4G1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G1"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADU34707.1"
FT                   /translation="MTRRLLSRCGHWVFAMATVLLFAGCATLPDEAPRAPAKAMGVSAD
FT                   TALGKIALASQPDPDLSGFRLMPGGDFAFDTRIQLARRAQRTLDVQYYQIENDETGRYL
FT                   LRTLRDAAQRGVRVRLLMDDLYTSGEDELLLGLAATPNVELRLFNPFPAGRGSLLKRFT
FT                   ASLFDFSRVNRRMHNKLFIADGAMAVAGGRNIGNQYFTRTSGENFIDLDTFVTGALIPR
FT                   LGVLFDQYWNSVYVRPVQSIIASDLSREELQRRFEAATGPDTTPPPPKPAPNDLLGYSP
FT                   MADDLNAGKLGLIWTLAEAYADSPERVIGKTASYGGVPLLDVDSVRYNVVEQMRRARSE
FT                   VTIVSPYLIPGAAGLEVMKEIRGRNVKISVVTNSLAATDEPLVHTAYRRYRPEMLKLGA
FT                   DLYELSTTRTRRSVRLGLFGTSVGRLHAKSAVIDQRILFVGSMNFDPRSETHNTEIGLF
FT                   IRSAEMAQQALKLIDVLKQQGAYRLRFVEGSGESHIEWTSEDAGKTTVLNEEPDSGFWD
FT                   RTMLELLAPLTPESLL"
     MTRRLLSRCG HWVFAMATVL LFAGCATLPD EAPRAPAKAM GVSADTALGK IALASQPDPD        60
     LSGFRLMPGG DFAFDTRIQL ARRAQRTLDV QYYQIENDET GRYLLRTLRD AAQRGVRVRL       120
     LMDDLYTSGE DELLLGLAAT PNVELRLFNP FPAGRGSLLK RFTASLFDFS RVNRRMHNKL       180
     FIADGAMAVA GGRNIGNQYF TRTSGENFID LDTFVTGALI PRLGVLFDQY WNSVYVRPVQ       240
     SIIASDLSRE ELQRRFEAAT GPDTTPPPPK PAPNDLLGYS PMADDLNAGK LGLIWTLAEA       300
     YADSPERVIG KTASYGGVPL LDVDSVRYNV VEQMRRARSE VTIVSPYLIP GAAGLEVMKE       360
     IRGRNVKISV VTNSLAATDE PLVHTAYRRY RPEMLKLGAD LYELSTTRTR RSVRLGLFGT       420
     SVGRLHAKSA VIDQRILFVG SMNFDPRSET HNTEIGLFIR SAEMAQQALK LIDVLKQQGA       480
     YRLRFVEGSG ESHIEWTSED AGKTTVLNEE PDSGFWDRTM LELLAPLTPE SLL              533
//

If you have problems or comments...

PBIL Back to PBIL home page