(data stored in ACNUC1104 zone)

EMBL: CP002417.PE485

CP002417.PE485       Location/Qualifiers
FT   CDS             complement(526263..526910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0486"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   vap:Vapar_0468 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34708"
FT                   /db_xref="GOA:E6V4G2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G2"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADU34708.1"
FT                   /translation="MMDTTLSLLGIAGAMTVGAMSPGPSFVMVARTAVASRSDGLAAAL
FT                   GMGAGGLVFAIAALAGLQAAFLAVPGLYLAIKGFGGAYLIYLGFLIWRGARQPLAMTQD
FT                   ADASSTPQQGRGRRTFLLGLATQVSNPKTAVVYASIFAAFLPREVPLVLALAVPVVIFC
FT                   IETGWYAIVALALSSAAPRSAYLRYKVWIDRAAGGVMGLLGLRLVWSAVSES"
     MMDTTLSLLG IAGAMTVGAM SPGPSFVMVA RTAVASRSDG LAAALGMGAG GLVFAIAALA        60
     GLQAAFLAVP GLYLAIKGFG GAYLIYLGFL IWRGARQPLA MTQDADASST PQQGRGRRTF       120
     LLGLATQVSN PKTAVVYASI FAAFLPREVP LVLALAVPVV IFCIETGWYA IVALALSSAA       180
     PRSAYLRYKV WIDRAAGGVM GLLGLRLVWS AVSES                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page