(data stored in SCRATCH zone)

EMBL: CP002417.PE486

CP002417.PE486       Location/Qualifiers
FT   CDS             complement(526924..527577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0487"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: vap:Vapar_0469 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34709"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G3"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADU34709.1"
FT                   /translation="MSLIPYAMKKLLLASALSAAALPFAAIAQEYTAPAVAAKPAGGPV
FT                   KNGNYVIDPTHTFVMYEMGHYGTTTNRGRFSTKDGSVQIDGSGTSGKVDITMDIGTINT
FT                   GVDLLNRHVQSKDFFNVAEFPTGRFVADRIEFSGDKVVDVPGTLTLMGQTKPVTLKAVR
FT                   FNCYLNPLINRQVCGGDFETTVQRSDWGINWGLNFGFENKVKLLVQVEAVNVQQ"
     MSLIPYAMKK LLLASALSAA ALPFAAIAQE YTAPAVAAKP AGGPVKNGNY VIDPTHTFVM        60
     YEMGHYGTTT NRGRFSTKDG SVQIDGSGTS GKVDITMDIG TINTGVDLLN RHVQSKDFFN       120
     VAEFPTGRFV ADRIEFSGDK VVDVPGTLTL MGQTKPVTLK AVRFNCYLNP LINRQVCGGD       180
     FETTVQRSDW GINWGLNFGF ENKVKLLVQV EAVNVQQ                                217
//

If you have problems or comments...

PBIL Back to PBIL home page