(data stored in ACNUC1104 zone)

EMBL: CP002417.PE487

CP002417.PE487       Location/Qualifiers
FT   CDS             complement(527606..528184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0488"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: vap:Vapar_0470 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34710"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G4"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADU34710.1"
FT                   /translation="MTRLFLPLLTALLLAAATMPAAADPAAKLIADKSQIAFVTKQMGV
FT                   PMEGAFKKFDAQIAFDPKKPEGGTVALQIDAASAGFGVPMSDAELPKAPWFDAAKFPQA
FT                   SFQSSAIKALGDGKFEMAGKLTIKGTSKYLTVPVTIAPAGGNYAVATGYFTIQRLDYKV
FT                   GDGEWTDTSVVGNDVQVRFKLTLAGLGPL"
     MTRLFLPLLT ALLLAAATMP AAADPAAKLI ADKSQIAFVT KQMGVPMEGA FKKFDAQIAF        60
     DPKKPEGGTV ALQIDAASAG FGVPMSDAEL PKAPWFDAAK FPQASFQSSA IKALGDGKFE       120
     MAGKLTIKGT SKYLTVPVTI APAGGNYAVA TGYFTIQRLD YKVGDGEWTD TSVVGNDVQV       180
     RFKLTLAGLG PL                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page