(data stored in SCRATCH zone)

EMBL: CP002417.PE489

CP002417.PE489       Location/Qualifiers
FT   CDS             complement(528874..530664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0490"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="KEGG: vap:Vapar_0472 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34712"
FT                   /db_xref="GOA:E6V4G6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34712.1"
FT                   /translation="MTPTPAPSVAPAADASSDRFAIQCEVLRLSIRPIGPVLLVQYLLN
FT                   CGVAALFAWQYSLVRALVWIALITGVTVMRGFFPQRLPDPFTPESLRHAQRAHTLRTAV
FT                   WELAHGLAGVLLFNPERPDQQLLLGLMLMGMTLSSAFSVSFYTPATQLAITLLLAPVIV
FT                   TGLTLGAPTMMAVSVIGIGLTAMMWKLVAERSRQLEENIGLRLNERTLREQALAGLRAS
FT                   EQAQAERLRFFSAANHDLRQPVMAIGLQAEVLRQQLDTGADASAVQHTVVSLARAQQAL
FT                   EGLTNQLLEIGRIEAAVDPLRPVAVALAPLLQDLARQAGNGRVTVRCPAGAVAWTDAVS
FT                   LRRVLANLVDNAVKFTPRGRVLLAVRARHRGTERAWRVEVRDSGIGIAADSQERVFNDF
FT                   EQIGNAERNLQHGHGLGLAIVRRLAAQLGIEVSLRSAPGRGSVFGFELPAAQGYGAAAL
FT                   QPAPPPQASPEAAPALRPGLAVLVVEDNAVVADSLYALLRQWEVSPRVYASAAEALALA
FT                   DLRALDAALCDIRLPGALDGIALAERLQAQNPALTIALISADINEATQRLATERGWHAL
FT                   RKPVQPEELRGVLLRAPQRP"
     MTPTPAPSVA PAADASSDRF AIQCEVLRLS IRPIGPVLLV QYLLNCGVAA LFAWQYSLVR        60
     ALVWIALITG VTVMRGFFPQ RLPDPFTPES LRHAQRAHTL RTAVWELAHG LAGVLLFNPE       120
     RPDQQLLLGL MLMGMTLSSA FSVSFYTPAT QLAITLLLAP VIVTGLTLGA PTMMAVSVIG       180
     IGLTAMMWKL VAERSRQLEE NIGLRLNERT LREQALAGLR ASEQAQAERL RFFSAANHDL       240
     RQPVMAIGLQ AEVLRQQLDT GADASAVQHT VVSLARAQQA LEGLTNQLLE IGRIEAAVDP       300
     LRPVAVALAP LLQDLARQAG NGRVTVRCPA GAVAWTDAVS LRRVLANLVD NAVKFTPRGR       360
     VLLAVRARHR GTERAWRVEV RDSGIGIAAD SQERVFNDFE QIGNAERNLQ HGHGLGLAIV       420
     RRLAAQLGIE VSLRSAPGRG SVFGFELPAA QGYGAAALQP APPPQASPEA APALRPGLAV       480
     LVVEDNAVVA DSLYALLRQW EVSPRVYASA AEALALADLR ALDAALCDIR LPGALDGIAL       540
     AERLQAQNPA LTIALISADI NEATQRLATE RGWHALRKPV QPEELRGVLL RAPQRP           596
//

If you have problems or comments...

PBIL Back to PBIL home page