(data stored in ACNUC1104 zone)

EMBL: CP002417.PE49

CP002417.PE49        Location/Qualifiers
FT   CDS             51358..52245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0049"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="KEGG: pol:Bpro_0068 transglutaminase-like; PFAM:
FT                   transglutaminase domain-containing protein; SMART:
FT                   transglutaminase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34272"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS8"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADU34272.1"
FT                   /translation="MHISHIDAQLDYEVTAPAHMLLNIEAARSGAQAVVEETLTIEPPT
FT                   EMQVFCDEGSGNRFIRFDAKPGSLKIGYRATVQRSHVHVPPDLCEVPVNEVPDEVLHYM
FT                   MPTRYCESDLMSRCAQQLFGELPPGIGRVQAIVDWIHDSIAYEPGSTDSTTTAREVFVE
FT                   RAGVCRDFAHLGITFCRALNIPARLVVGYVWFDEPPQDFHAVFEAWLGGQWVLFDPTRM
FT                   APVDRLVRVGTGRDAKDVAFCTIFGAVRMTDKKLVVRELQDESVPPPAAPAPSGALVGI
FT                   EKPVPVTQLAETTA"
     MHISHIDAQL DYEVTAPAHM LLNIEAARSG AQAVVEETLT IEPPTEMQVF CDEGSGNRFI        60
     RFDAKPGSLK IGYRATVQRS HVHVPPDLCE VPVNEVPDEV LHYMMPTRYC ESDLMSRCAQ       120
     QLFGELPPGI GRVQAIVDWI HDSIAYEPGS TDSTTTAREV FVERAGVCRD FAHLGITFCR       180
     ALNIPARLVV GYVWFDEPPQ DFHAVFEAWL GGQWVLFDPT RMAPVDRLVR VGTGRDAKDV       240
     AFCTIFGAVR MTDKKLVVRE LQDESVPPPA APAPSGALVG IEKPVPVTQL AETTA            295
//

If you have problems or comments...

PBIL Back to PBIL home page